SecReT6
Protein ID: 401764616
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15790
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3368176..3368646 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDJ7GE21
KEGG IDeno:ECENHK_15790
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.80E-35, Aligned region: 13..147
Protein Sequence: 156 a.a.     [Download]
>gi|401764616|ref|YP_006579623.1| type VI secretion lipoprotein [Enterobacter cloacae subsp. cloacae ENHKU01]
MTQSVTDGTRSAFNAVFYKKIKVLHLDFTAREALNTDSRENHSLSEPVVVRIYQLKDRKTFDKTVYQQLL
QDDATLLKEDLLASRDVVVKPGGDANLDMPMEEAAQFVAVVGLFRHPDMTNNTWKQVINRSELDPDKPRI
LEAGDNSLTLQPLKDD
 
Nucleotide Sequence: 471 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3368646-3368176 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
GTGACGCAGAGCGTCACTGACGGTACCAGGTCAGCGTTTAATGCCGTGTTCTATAAAAAAATTAAAGTAC
TGCATCTGGACTTCACCGCACGTGAGGCGCTGAACACCGACTCCCGGGAAAATCATTCGTTGTCTGAACC
TGTGGTGGTCCGGATTTACCAGCTCAAAGACCGCAAAACCTTTGATAAGACGGTCTATCAGCAACTGCTT
CAGGATGATGCCACCCTTCTGAAAGAGGACCTGCTGGCGAGTCGTGATGTCGTGGTGAAACCGGGCGGTG
ATGCAAACCTCGATATGCCCATGGAAGAAGCGGCACAGTTTGTTGCTGTGGTGGGGCTGTTTCGCCATCC
GGATATGACCAACAATACCTGGAAGCAGGTAATCAACCGCAGCGAACTGGATCCGGACAAACCCCGCATT
CTGGAGGCTGGCGATAACTCTCTGACACTGCAACCACTTAAGGACGACTAA