SecReT6
Protein ID: 401764617
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15795
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3368699..3369784 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDJ7GKQ0
KEGG IDeno:ECENHK_15795
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.30E-76, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|401764617|ref|YP_006579624.1| type VI secretion protein [Enterobacter cloacae subsp. cloacae ENHKU01]
MGREAQPAYSRLTPRLEAELHRINFYRLCQLLEKRYPGRPLMGSTSHPADDPVRFASHPGMGFPASELKA
VEYDEDDSGKPPVIRTTFMGMYGVDSPLPTAYLDDITQRREGHDALQGFLDIFSHRILTQFYRIWRKYSY
PATFEPGGSDSISQSLLGLVGLGIPGTANHIATPVSRFLALLGVLQQPGKTQEGMQALVSLLAPDTRVKV
SPYCLRPVEIGKPLGFYGDDDFLLDGNTPLGDEAMDAGSQLLVALKTDNEQEAQGWKPDGLLYQDFLVML
RVYLGWRFKARITLTTPVRLLAAPPLGENPFWLGMNGVLGAEADSLPDDIPETFTTELGYYRGLEPAKPQ
QGNRRVTYKFN
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3369784-3368699 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGGAAGAGAAGCACAACCGGCGTATTCCCGGCTGACCCCGCGGCTGGAAGCCGAACTTCACCGCATCA
ACTTTTACCGTTTATGCCAGCTGCTGGAGAAACGTTATCCTGGCAGACCGCTGATGGGATCGACCAGCCA
TCCGGCGGATGACCCGGTACGCTTTGCGTCGCATCCGGGGATGGGGTTCCCGGCCAGCGAGCTGAAAGCG
GTTGAATACGACGAGGATGATAGCGGCAAGCCGCCGGTTATTCGCACCACGTTTATGGGGATGTACGGCG
TCGACTCACCGTTACCGACGGCCTATCTCGATGACATTACGCAGCGACGGGAAGGGCATGACGCGCTGCA
GGGCTTTCTGGATATCTTCAGTCACCGCATCCTGACGCAGTTTTACCGCATCTGGCGTAAATACTCCTAT
CCTGCCACGTTTGAACCGGGCGGTAGCGACAGCATTTCACAGTCGCTGCTGGGCCTGGTGGGGCTGGGTA
TACCGGGTACGGCAAACCATATTGCCACGCCAGTGTCGCGCTTTCTGGCGCTGCTGGGCGTTCTGCAGCA
GCCAGGCAAAACCCAGGAAGGGATGCAGGCGCTGGTGAGCCTGCTTGCTCCGGATACCCGCGTAAAGGTC
AGCCCGTACTGCCTTCGACCGGTGGAGATCGGTAAGCCGCTGGGTTTTTACGGTGATGACGATTTCCTGC
TTGATGGCAATACGCCTTTAGGGGACGAAGCAATGGATGCGGGCAGCCAGCTGCTGGTCGCGCTCAAGAC
CGATAACGAACAGGAAGCGCAGGGCTGGAAACCGGATGGTCTGCTTTATCAGGATTTTCTGGTGATGCTG
CGGGTGTACCTGGGATGGCGGTTTAAGGCCAGGATCACCCTGACCACGCCTGTCCGACTGCTGGCCGCCC
CTCCTTTAGGCGAAAATCCTTTCTGGCTGGGAATGAACGGCGTGCTGGGAGCTGAAGCTGACAGCCTTCC
TGATGATATTCCTGAGACCTTTACGACAGAGCTGGGTTATTACCGCGGGCTGGAGCCTGCGAAACCACAA
CAAGGAAACCGACGTGTTACGTACAAGTTTAACTAA