SecReT6
Protein ID: 401764618
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15800
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3369748..3371502 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDJ7GF93
KEGG IDeno:ECENHK_15800
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-179, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|401764618|ref|YP_006579625.1| type VI secretion protein [Enterobacter cloacae subsp. cloacae ENHKU01]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPYVERLFEGFAFMMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSMSVVEFTPDWREMKEQMRIVKGFEVNSRPIGEKGTRCRYTTTKEITLQPLS
LEHARLSTDPDGRSVISLRFNCSPLADWSRVDLSLIPLYFNADAPLACAMHEAFTMNVARLWLRMPGGMD
RKPLDGYFTALGFGDDDDLWPKGSSSFSGYQLLLEYFTFREKFMFTGLRGLESVVFPAELPWFEIDVVLA
ERWEYDFSFTEKHLRLNCVPVINLFPLESDPLTLNSLQTEYLLRPMRVQDGHTEIYAVDSVMSSSQHTYV
PFSSFRHKGGMMRHEAPEYYYHTRVRRGPSGLHNTWLILGGEAFDNHTVPADESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSASIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSGFLSMMDNADVLRGTLALYEWTD
SEMNRRRLEAIIDVKHSETERFEQGYLVRGVQIEVTLDSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHNRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3371502-3369748 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGACGATTTAACCCTGCGTTATTACGACGCCGAAATGCGCTATCTGCTGGAAGCCGGAGAAGAGTTTG
CCCGTGCTCATCCCGAGCAGGCGGCAATGCTCAACCTCGATAAAGCGGGCGCGCGGGACCCGTACGTGGA
GCGCCTGTTTGAAGGCTTTGCCTTCATGATGGGTCGGCTGCGTGAGAAACTCGACGATGATCTGCCCGAA
CTGACCGAAGGGCTGGTCAGCCTGTTATGGCCGCATTACCTGCGTACGATTCCGTCGATGTCGGTGGTGG
AATTCACCCCTGACTGGCGTGAAATGAAAGAGCAGATGCGTATTGTCAAAGGCTTCGAGGTTAATTCACG
GCCAATCGGCGAGAAGGGCACGCGCTGCCGGTACACCACCACCAAAGAGATTACCCTTCAGCCCTTGTCG
CTGGAGCACGCCCGCCTGTCGACCGATCCTGATGGGCGTTCAGTTATCAGCCTGCGCTTCAACTGCAGCC
CTCTTGCCGACTGGAGCCGTGTCGATCTCAGCCTGATCCCGCTTTACTTTAACGCTGATGCACCACTCGC
CTGCGCCATGCATGAAGCTTTTACCATGAATGTTGCTCGCCTGTGGCTACGGATGCCAGGCGGCATGGAC
AGAAAACCGCTCGACGGGTATTTCACCGCGCTGGGATTTGGCGATGACGACGACCTGTGGCCGAAGGGCA
GCAGCAGCTTTAGCGGATATCAGCTGTTGCTGGAGTACTTCACCTTCCGCGAGAAATTCATGTTCACCGG
CCTGCGTGGTCTGGAAAGCGTGGTCTTTCCGGCTGAACTTCCCTGGTTTGAAATCGACGTGGTGCTGGCG
GAACGCTGGGAGTATGACTTCAGCTTTACCGAAAAGCATCTGCGCCTGAACTGCGTGCCGGTGATAAACC
TGTTCCCGCTGGAATCTGACCCGCTTACGCTCAACTCATTGCAAACTGAATACCTGCTGCGGCCGATGCG
CGTGCAGGACGGTCATACAGAGATTTACGCGGTCGATTCAGTGATGTCATCGAGTCAGCATACCTACGTG
CCGTTTTCCAGCTTCCGCCACAAAGGCGGCATGATGCGCCATGAAGCGCCGGAATATTATTACCACACCC
GCGTGCGTCGCGGCCCGTCGGGTTTGCACAATACCTGGCTTATTCTTGGCGGTGAAGCGTTTGATAACCA
CACGGTACCGGCAGACGAGAGCCTGTCCCTGACGCTCACCGGCACCAACGGCCAGCTTCCGCGACGGGCG
CTGCAAAGCACCGTGCTCGATACGGTGATGAAAACCACGTCAGCCAGCATCGCCGTACGTAACCTCTGTG
CGCCAACGCTGCCCTGTTATCCCCCGGCCCAGGATCGTTTCCACTGGCGCGTGCTGAGCCACCTTGGCAG
CGGTTTCCTGTCGATGATGGACAACGCCGACGTGCTGCGCGGCACCCTGGCGCTCTATGAGTGGACCGAC
AGCGAGATGAATCGCCGTCGCCTGGAAGCGATCATTGATGTGAAGCACAGCGAAACCGAGCGCTTCGAAC
AAGGTTACCTTGTTCGCGGCGTGCAGATTGAAGTCACGCTCGATAGCCACGGTTTTGCCGGGCGCGGCGA
CATCTGTCTGTTCGGCGAGATGCTGAGCCGCTTCTTTGCGCTCTATACCGATATCTATCTGTTTAACCGC
CTGATTATTATTCTGCAACCGACCGGAGAACGCCTGGAATGGGAAGAGAAGCACAACCGGCGTATTCCCG
GCTGA