SecReT6
Protein ID: 401764619
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15805
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3371543..3373141 [-]
Producttype VI secretion system protein VasJ
NoteTssA
UniProt IDJ7GN43
KEGG IDeno:ECENHK_15805
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 67..126
Protein Sequence: 532 a.a.     [Download]
>gi|401764619|ref|YP_006579626.1| type VI secretion system protein VasJ [Enterobacter cloacae subsp. cloacae ENHKU01]
MDTLQNLIAACQADETQLRKQAQARTESWHPWLAPVNETRATGEEPGYDDDFQRIREEVNKLSGIDTGLI
CTLAEKLLTTTAKDIRIATYYCWARLHQDGETGFAEGLELVAGLLQRYGTQLHPQRERSRKPALEWLAGS
RLLDSLSLWPEVVRDDALRTAGALLLIHDALQTEPETSRPELNALYSALESRLMKAGGVDAVVPQNAGNQ
SQLPASYSTESDAPVMSRITSGQDLLAQARTLTGYLREQPDGWLAAHRLMKSLRHDTLSAIPAPDAEGKT
RIEPPRADQRAMLKRLYLQQSWLEILEQADSTFSRGANHLWLDLQWYIHQALVKLGQDVLADIITADLKG
LLRRLTGLETLAFNDGTPFADEVTLNWINQSVLDDMSGWRDEPVSAGSGEDNDILTLEPEALEKADTDGL
DAALHWLQTRPGTDAIKDKWLLRLLMARIAEQKGKNELALHLLGELDSTAQSITLTQWTPALLFEVKSRR
LRLLRMKASRSETDRSRLQPEMDLLLSGLIALDPASSAVLCG
 
Nucleotide Sequence: 1599 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3373141-3371543 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGACACTCTGCAGAATCTGATTGCCGCCTGTCAGGCGGACGAAACCCAGCTGCGAAAGCAGGCTCAGG
CACGCACGGAAAGTTGGCACCCCTGGCTTGCCCCGGTAAATGAGACCCGTGCAACAGGAGAAGAGCCCGG
GTATGACGATGATTTTCAGCGCATAAGAGAGGAGGTGAATAAACTCTCCGGTATCGATACGGGACTGATT
TGTACGCTTGCCGAAAAACTGCTGACGACTACCGCCAAAGATATCCGCATTGCGACCTATTACTGCTGGG
CGCGATTGCACCAGGACGGTGAAACAGGCTTTGCCGAAGGGCTTGAGTTAGTGGCGGGATTGCTGCAGCG
CTACGGAACGCAACTTCATCCGCAGCGGGAGCGAAGCCGTAAGCCCGCGCTGGAGTGGCTTGCAGGTTCT
CGTCTGCTTGACAGCCTGTCACTCTGGCCAGAAGTGGTCCGCGACGATGCCCTTCGCACGGCAGGCGCGC
TGTTGCTCATCCATGACGCTCTGCAAACAGAGCCGGAAACGTCACGACCCGAGCTGAATGCCCTGTACAG
CGCGCTGGAATCCCGCCTGATGAAGGCGGGGGGCGTGGATGCCGTGGTACCTCAGAATGCCGGTAATCAG
TCCCAACTCCCGGCTTCGTACTCGACGGAGTCTGACGCACCCGTTATGAGCCGCATCACGTCCGGTCAGG
ATCTGCTGGCGCAGGCACGCACGTTGACCGGGTATCTGCGTGAACAACCCGATGGCTGGCTTGCCGCTCA
CCGGCTGATGAAGAGCCTGAGGCATGACACCCTGAGCGCTATTCCTGCACCGGATGCCGAAGGGAAAACA
CGCATTGAACCACCCCGGGCAGACCAGCGGGCGATGCTGAAACGCCTGTACCTGCAGCAGAGCTGGCTGG
AGATACTGGAGCAGGCGGACAGCACCTTCTCGCGTGGCGCTAATCACCTCTGGCTGGATCTGCAGTGGTA
TATCCATCAGGCGCTGGTGAAGTTGGGGCAGGATGTGCTGGCCGACATCATCACCGCCGACCTGAAAGGG
CTGCTGCGCCGCCTTACCGGACTGGAAACCCTGGCTTTTAATGACGGGACGCCATTTGCCGATGAGGTCA
CGCTGAACTGGATTAATCAGAGCGTACTGGACGATATGTCCGGCTGGCGGGATGAGCCGGTCAGTGCCGG
CAGTGGAGAGGATAACGATATCCTGACCCTCGAGCCGGAAGCGCTGGAGAAAGCGGACACGGACGGTCTG
GACGCGGCACTCCATTGGCTGCAGACCCGCCCGGGCACCGACGCCATAAAAGACAAATGGCTGCTGCGCC
TGCTGATGGCGCGTATAGCCGAGCAGAAGGGCAAAAATGAACTTGCCCTCCATCTGCTGGGCGAGCTGGA
CAGTACAGCACAGTCCATCACCCTCACGCAGTGGACACCGGCGCTGTTGTTTGAAGTCAAATCCCGCCGA
CTCAGACTGCTGCGCATGAAAGCCTCGCGCAGCGAAACCGACAGATCACGGCTTCAGCCTGAGATGGATT
TGCTTCTGTCCGGTCTGATTGCGCTCGATCCGGCAAGCAGTGCGGTGCTTTGCGGGTAA