SecReT6
Protein ID: 401764630
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15860
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3384931..3387309 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDJ7GIL2
KEGG IDeno:ECENHK_15860
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-64, Aligned region: 34..356
DUF2345 [PF10106], Evalue: 1.50E-40, Aligned region: 614..760
T6SS_Vgr [PF13296], Evalue: 3.60E-35, Aligned region: 489..591
T6SS_Vgr [PF13296], Evalue: 3.60E-35, Aligned region: 629..675
Phage_base_V [PF04717], Evalue: 1.50E-16, Aligned region: 389..482
DUF3540 [PF12059], Evalue: 0.0049, Aligned region: 634..676
DUF3540 [PF12059], Evalue: 0.0049, Aligned region: 670..719
DUF3540 [PF12059], Evalue: 0.0049, Aligned region: 715..753
Protein Sequence: 792 a.a.     [Download]
>gi|401764630|ref|YP_006579637.1| Rhs element Vgr protein [Enterobacter cloacae subsp. cloacae ENHKU01]
MSTTPPIRYSHNHHLLAVKGCEAEPDVLAFDGDEALSRPFSYRIEFTSRDHGISKEMMLMKSGSLTLQAP
VDQGYGIKIQQPLRVIQGVVTGFERLGTSRDETHYALSLRPRLALLDRSHQNAIYQDMSVPQIVEKILRE
RHGMRGQDFLFSLTREYPRREQVMQYGENDLHFITRLLGEVGIWFRFTTDTRLNIDVVEFYDGQQGYEKG
LTLPSVPPSGQHSQGVDAVWGMESHHSVVQKQVSTRDYNYRQATQDMNAQVDVTRGDTTTYGEAYHYADN
YLTPGIAYERHPAPESGAFYARIRHERYLNGQTQARAITSSPALSPGQVLKVTGGYEVAEVFARGVVITA
MRSHARRDEDFCIHFDGIPDSADFSFRPEPGPRPVMAGTLPARVTSTTENDTYGHIDKDGRYRVNMLFDR
DSWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYITGVLHDSAHGDHVTIRNYKRN
VLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAEKQPRGEGFELRTDSWGAIRAQKGIFISA
DGQAKAQGQVLEMQPAVSLLKGALNQVTEWGSITQTHHNFSPDADSLRAFVCGADNLKEAAILMSAPDGI
AAVTPETTLLHSGKGLYLQSLGEVNIASAQRHSVNAEKAISVLARQEGIRLVSAKGPMTLESHADTLSLT
SLKDITVQSTQGHLQLTAKNGITIGCGGAYIRLTPQGEIHIHGPGQLSLKGQHKMLGPQSEDFPLPELPS
SVCKDCLKRAQEMAKGFVPREG
 
Nucleotide Sequence: 2379 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3387309-3384931 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGAGCACCACTCCACCGATCAGATACAGCCACAACCACCACCTTCTGGCGGTGAAAGGCTGTGAGGCCG
AACCCGACGTGCTGGCCTTTGACGGCGACGAAGCCCTGAGCCGACCGTTCAGCTACCGCATTGAGTTTAC
CAGCCGCGACCACGGTATCAGCAAAGAAATGATGCTGATGAAATCCGGCTCGCTGACGCTGCAGGCCCCG
GTTGACCAGGGTTACGGCATCAAAATACAGCAGCCGCTGCGGGTGATTCAGGGCGTGGTGACCGGTTTTG
AGCGGCTCGGCACGTCCAGGGATGAAACGCATTACGCCCTGTCGCTGCGGCCACGCCTGGCGCTGCTGGA
CCGTTCGCACCAGAACGCGATTTACCAGGACATGTCGGTGCCGCAAATTGTGGAAAAAATCCTGCGCGAG
CGTCACGGCATGCGCGGCCAGGATTTTCTGTTCTCGCTGACCAGGGAGTACCCGCGCCGCGAGCAGGTGA
TGCAGTACGGCGAGAACGACCTGCACTTCATCACCCGCCTGCTGGGTGAGGTGGGTATCTGGTTCCGCTT
CACCACCGACACGCGCCTGAACATCGACGTGGTGGAGTTTTACGACGGTCAGCAGGGGTATGAGAAAGGC
CTGACCCTGCCGTCGGTCCCGCCTTCAGGGCAGCACTCGCAGGGCGTGGACGCGGTGTGGGGGATGGAGA
GCCATCACAGCGTGGTGCAGAAGCAGGTCAGCACCCGGGACTACAACTACCGCCAGGCCACGCAGGACAT
GAACGCGCAGGTGGATGTGACCCGCGGGGATACGACCACTTACGGGGAAGCGTACCACTATGCCGACAAT
TATCTGACGCCGGGCATCGCGTATGAGCGTCATCCGGCACCCGAGTCCGGGGCGTTTTATGCCCGCATCC
GGCATGAGCGCTACCTGAATGGCCAGACGCAGGCCCGGGCCATCACCAGCAGCCCGGCACTCTCTCCCGG
CCAGGTGCTGAAGGTCACCGGCGGGTATGAAGTGGCAGAGGTGTTTGCCCGCGGTGTGGTTATCACGGCG
ATGCGCAGCCATGCGCGGCGGGATGAAGATTTTTGCATTCATTTTGACGGTATTCCGGACAGTGCAGATT
TCAGCTTCCGCCCGGAGCCGGGCCCGCGTCCGGTGATGGCCGGTACGCTGCCGGCCCGCGTCACCAGCAC
CACCGAAAATGACACCTACGGCCATATTGATAAGGACGGCCGCTATCGCGTGAACATGCTGTTTGACCGT
GACAGCTGGGAGACCGGGTTCGAGAGCCTGTGGGTGCGCCAGTCCCGCCCGTATGCCGGGGACACCTACG
GCCTGCATCTGCCGCTGCTGGCGGGTACCGAAGTGGCGATTGGTTTTGAGGACGGTAACCCGGACCGCCC
GTACATTACCGGCGTGCTGCACGACTCGGCGCACGGGGACCACGTCACCATCCGCAACTATAAGCGTAAC
GTGCTGCGTACCCCGGCGAACAACAAAATCCGCCTTGATGACGAGCGCGGGAAAGAGCACATCAAGGTCA
GCACGGAGTACGGCGGCAAGAGCCAGCTGAATCTCGGGCATTTAGTGGATGCTGAAAAACAACCGCGCGG
GGAGGGTTTTGAGCTCCGGACGGACAGCTGGGGCGCCATCCGGGCGCAGAAAGGGATTTTTATCTCGGCG
GACGGTCAGGCGAAAGCGCAGGGGCAGGTGCTGGAGATGCAGCCTGCGGTCAGCCTGCTAAAAGGGGCGC
TGAATCAGGTCACGGAGTGGGGAAGCATCACGCAGACGCATCACAACTTCTCGCCTGATGCAGATTCCCT
GAGAGCGTTCGTCTGTGGAGCAGACAATCTGAAAGAGGCTGCCATATTGATGTCTGCGCCTGACGGCATC
GCAGCAGTTACGCCTGAAACCACGCTGTTACACAGTGGAAAAGGGCTTTACCTGCAGAGCCTGGGCGAGG
TCAATATTGCTTCAGCGCAGCGTCATTCCGTCAATGCCGAAAAAGCAATTTCAGTGCTGGCCCGGCAGGA
GGGGATTCGGCTGGTTTCTGCGAAGGGCCCGATGACGCTGGAGTCTCACGCTGACACCTTGTCACTGACG
TCGCTGAAAGACATTACCGTGCAGTCCACGCAGGGGCACCTGCAGCTGACGGCGAAAAACGGTATCACCA
TTGGATGTGGCGGAGCGTATATACGGCTGACGCCGCAGGGAGAGATTCATATTCACGGGCCAGGGCAGTT
GAGCCTGAAAGGTCAACACAAGATGCTGGGGCCGCAGAGCGAAGATTTTCCGTTGCCGGAACTTCCCTCC
TCGGTCTGCAAGGACTGTCTGAAAAGGGCTCAGGAGATGGCTAAAGGATTTGTGCCAAGGGAGGGTTAA