SecReT6
Protein ID: 401764631
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15865
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3387306..3389960 [-]
Producthypothetical protein
NoteTssH
UniProt IDJ7GE33
KEGG IDeno:ECENHK_15865
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-41, Aligned region: 236..255
AAA_2 [PF07724], Evalue: 1.80E-41, Aligned region: 451..497
AAA_2 [PF07724], Evalue: 1.80E-41, Aligned region: 610..775
AAA [PF00004], Evalue: 6.90E-20, Aligned region: 238..350
AAA [PF00004], Evalue: 6.90E-20, Aligned region: 479..526
AAA [PF00004], Evalue: 6.90E-20, Aligned region: 615..737
AAA [PF00004], Evalue: 6.90E-20, Aligned region: 763..780
AAA_5 [PF07728], Evalue: 8.90E-15, Aligned region: 238..260
AAA_5 [PF07728], Evalue: 8.90E-15, Aligned region: 335..368
AAA_5 [PF07728], Evalue: 8.90E-15, Aligned region: 614..735
ClpB_D2-small [PF10431], Evalue: 4.50E-13, Aligned region: 383..407
ClpB_D2-small [PF10431], Evalue: 4.50E-13, Aligned region: 781..856
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 140..157
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 215..259
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 476..516
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 584..638
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 678..708
AAA_16 [PF13191], Evalue: 9.90E-13, Aligned region: 753..806
AAA_25 [PF13481], Evalue: 5.00E-08, Aligned region: 238..269
AAA_25 [PF13481], Evalue: 5.00E-08, Aligned region: 292..326
AAA_25 [PF13481], Evalue: 5.00E-08, Aligned region: 610..643
AAA_22 [PF13401], Evalue: 7.90E-08, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 7.90E-08, Aligned region: 357..398
AAA_22 [PF13401], Evalue: 7.90E-08, Aligned region: 611..633
AAA_22 [PF13401], Evalue: 7.90E-08, Aligned region: 675..706
AAA_22 [PF13401], Evalue: 7.90E-08, Aligned region: 788..813
Arch_ATPase [PF01637], Evalue: 3.70E-07, Aligned region: 216..258
Arch_ATPase [PF01637], Evalue: 3.70E-07, Aligned region: 479..500
Arch_ATPase [PF01637], Evalue: 3.70E-07, Aligned region: 607..628
Arch_ATPase [PF01637], Evalue: 3.70E-07, Aligned region: 684..696
IstB_IS21 [PF01695], Evalue: 8.60E-07, Aligned region: 232..299
IstB_IS21 [PF01695], Evalue: 8.60E-07, Aligned region: 614..632
AAA_17 [PF13207], Evalue: 7.00E-06, Aligned region: 238..303
AAA_17 [PF13207], Evalue: 7.00E-06, Aligned region: 613..649
AAA_17 [PF13207], Evalue: 7.00E-06, Aligned region: 796..816
Zeta_toxin [PF06414], Evalue: 8.60E-06, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 8.60E-06, Aligned region: 601..654
NACHT [PF05729], Evalue: 1.00E-05, Aligned region: 238..269
NACHT [PF05729], Evalue: 1.00E-05, Aligned region: 492..509
NACHT [PF05729], Evalue: 1.00E-05, Aligned region: 614..632
AAA_19 [PF13245], Evalue: 2.20E-05, Aligned region: 235..264
AAA_19 [PF13245], Evalue: 2.20E-05, Aligned region: 610..632
Sigma54_activat [PF00158], Evalue: 6.60E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 6.60E-05, Aligned region: 612..731
AAA_29 [PF13555], Evalue: 0.00012, Aligned region: 232..254
AAA_29 [PF13555], Evalue: 0.00012, Aligned region: 610..640
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 238..328
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 612..696
Clp_N [PF02861], Evalue: 0.00015, Aligned region: 22..53
Clp_N [PF02861], Evalue: 0.00015, Aligned region: 104..121
AAA_18 [PF13238], Evalue: 0.0012, Aligned region: 238..260
AAA_18 [PF13238], Evalue: 0.0012, Aligned region: 615..634
DUF258 [PF03193], Evalue: 0.0028, Aligned region: 224..255
DUF258 [PF03193], Evalue: 0.0028, Aligned region: 613..626
SRP54 [PF00448], Evalue: 0.0039, Aligned region: 238..261
SRP54 [PF00448], Evalue: 0.0039, Aligned region: 613..644
RNA_helicase [PF00910], Evalue: 0.0039, Aligned region: 239..260
RNA_helicase [PF00910], Evalue: 0.0039, Aligned region: 615..635
RNA_helicase [PF00910], Evalue: 0.0039, Aligned region: 712..733
AAA_33 [PF13671], Evalue: 0.0088, Aligned region: 238..255
AAA_33 [PF13671], Evalue: 0.0088, Aligned region: 398..445
AAA_33 [PF13671], Evalue: 0.0088, Aligned region: 613..631
AAA_28 [PF13521], Evalue: 0.009, Aligned region: 238..279
AAA_28 [PF13521], Evalue: 0.009, Aligned region: 614..633
Protein Sequence: 884 a.a.     [Download]
>gi|401764631|ref|YP_006579638.1| hypothetical protein ECENHK_15865 [Enterobacter cloacae subsp. cloacae ENHKU01]
MENPAILLRRLNPYCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDGIWQDLL
GWLDKQPRSVRHRPQLSENIQSLMQQAWLIASLAGEEHIRSVHLLMALVEKQNLVRCNGLWPLLTLGQSQ
LERLRPLLDAQSDERPEVQQEAELAQSHGGEVEFVGRPVGAEVKEGELNPALQNALDKFTLDVTAKAKEG
KIDPVFGRDTEIRQMVDILSRRRKNNPILVGDPGVGKTALVEGLALRIAEGNVPESLKTVVLRTLDLGLL
QAGAGVKGEFEQRLKNVIDAVQQSPVPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAEHHHVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTAAARVRMSIDTVPEQLIRYRASITALDMEKQALLEDIAIGNQSHAGRLSAIEQEEVNLI
VALDELESQYGQELKLTAQLLESRQDISRQSETHQLHQELHEMQHGNPLLSLDVDVRTVANVIADWTGVP
LSSLMKDEQTELLMLENEIGKRVVGQDTALKAVAQRLRAAKTGLTSENGPQGVFLLVGPSGVGKTETALA
LADVMYGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVM
NVFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDHLMQLLEEQPDATEGDLHELLRPILRDHFQPALL
ARFQTVIYRPLNEIAMRTIVEMKLSQVSRRLDRHYGLATHIDESLYDALTAACLLPDTGARNVDSLLNQQ
ILPVLSQQLLSHMAAKQKPKSLCLSWSEEEGIGLAFDWLQGDCV
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3389960-3387306 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGGAAAACCCGGCAATCCTCCTTCGACGTCTTAATCCATACTGCGCGCGGGCAATGGAAGGTGCAGCTT
CGCTCTGCCAGACTCGCGCGCATGCAGAAATTCTGCCGGAGCACTGGCTGCTGAAGCTGCTGGAGCAGGG
GGAAGGTGACCTGACGGTGCTGGCTCGCCGCTACGAATGGGATATGGACGGCATCTGGCAGGATTTACTG
GGCTGGCTGGATAAACAGCCGCGCTCGGTACGCCACCGGCCGCAGCTTTCAGAAAACATCCAGTCTCTGA
TGCAGCAAGCCTGGCTGATAGCCTCACTGGCGGGTGAAGAACATATCCGCAGTGTGCATTTACTGATGGC
ACTGGTTGAGAAACAAAACCTGGTGCGCTGCAACGGTCTGTGGCCTTTGCTGACCCTGGGCCAGAGTCAG
CTTGAGCGTCTTCGACCGTTGCTTGATGCGCAGTCAGATGAACGTCCGGAAGTGCAGCAGGAAGCGGAAC
TGGCGCAAAGTCATGGTGGAGAAGTCGAGTTCGTCGGGCGCCCTGTGGGTGCAGAAGTAAAAGAGGGAGA
ACTCAACCCTGCGTTGCAGAATGCGCTGGATAAATTCACCCTTGATGTCACTGCGAAGGCGAAAGAAGGC
AAAATCGATCCGGTGTTTGGTCGTGACACCGAAATTCGTCAGATGGTGGACATTCTCTCCCGTCGACGCA
AAAACAACCCGATTCTGGTTGGCGATCCGGGCGTGGGCAAAACCGCACTGGTTGAAGGCCTGGCGCTCAG
AATCGCCGAAGGCAATGTGCCGGAATCGCTTAAAACTGTGGTGCTACGTACGCTTGACCTCGGCCTGCTG
CAGGCGGGCGCGGGTGTGAAGGGGGAGTTTGAACAGCGTCTGAAAAACGTCATTGATGCAGTACAGCAGT
CCCCGGTACCCGTTCTGCTGTTTATCGACGAAGCGCATACCATCATCGGTGCTGGCAACCAGGCCGGTGG
CGCGGATGCAGCCAACCTGCTGAAGCCCGCGCTGGCGCGTGGTGAACTGCGGACAATTGCGGCCACCACC
TGGTCTGAATACAAACAATACTTTGAGCGCGATGCAGCCCTGGAACGCCGCTTCCAGATGGTAAAAGTCG
ATGAGCCGGATGACGACACTGCCTGCCTGATGCTGCGGGGCCTGAAATCCCGCTACGCCGAACATCACCA
CGTGCACATTACCGACGATGCGGTTCGTGCCGCAGTTACCCTGTCGCGCCGTTATCTGACGGGACGTCAA
CTTCCTGATAAAGCGGTGGATCTGTTGGATACCGCTGCCGCCCGCGTACGCATGAGCATCGACACGGTTC
CGGAGCAGCTTATTCGTTATCGCGCATCTATCACCGCACTCGACATGGAGAAGCAGGCGCTGCTGGAGGA
TATCGCGATTGGCAATCAGAGCCACGCTGGACGTCTGAGCGCGATAGAGCAGGAAGAGGTAAACCTGATT
GTGGCGCTCGATGAACTCGAAAGCCAGTACGGTCAGGAACTGAAGCTGACCGCTCAATTGCTCGAAAGCC
GTCAGGATATCTCGCGCCAGAGCGAGACTCACCAGCTGCATCAGGAGCTTCACGAGATGCAGCACGGTAA
CCCGCTGCTCTCCCTGGATGTGGATGTACGCACCGTGGCCAATGTGATAGCCGACTGGACAGGTGTGCCG
TTGTCATCGCTGATGAAAGACGAGCAAACCGAACTGCTGATGCTGGAAAATGAAATAGGGAAGCGCGTGG
TCGGGCAGGATACGGCGCTTAAGGCCGTCGCTCAGCGTCTGCGCGCGGCAAAAACGGGCCTCACGTCCGA
GAACGGCCCGCAGGGCGTATTCCTGCTGGTGGGGCCGAGTGGCGTCGGGAAAACTGAAACCGCGCTTGCG
CTGGCCGATGTCATGTATGGCGGCGAGAAGTCACTCATCACGATTAACCTTTCTGAATACCAGGAGCCAC
ATACGGTTTCGCAGCTGAAAGGCTCGCCTCCGGGTTATGTCGGGTACGGCCAGGGCGGAATTCTGACCGA
AGCCGTGCGAAAACGGCCGTACAGTGTAGTGCTACTGGATGAAGTGGAAAAAGCCCACCGCGATGTCATG
AATGTGTTCTATCAGGTCTTCGATCGCGGCTTTATGCGTGATGGAGAAGGTCGTGAAATCGACTTCCGCA
ATACTGTTATTCTGATGACCTCGAATCTCGGTAGTGACCACCTGATGCAGTTGCTGGAAGAACAGCCTGA
CGCCACCGAAGGCGACCTGCACGAATTGCTGCGCCCGATATTACGCGACCACTTCCAGCCGGCACTCCTG
GCCCGCTTCCAGACCGTGATTTACCGACCGCTCAACGAGATAGCTATGCGCACCATTGTTGAAATGAAGC
TGTCGCAGGTGAGCAGGCGTTTAGACCGTCACTATGGTCTGGCCACACATATCGATGAGAGCCTTTACGA
CGCGCTGACGGCAGCCTGCCTGCTGCCGGATACGGGCGCGCGCAACGTCGACAGTCTGCTGAATCAACAG
ATTTTGCCGGTGCTGAGTCAGCAGTTGCTCTCTCACATGGCCGCAAAACAAAAGCCAAAGTCGCTTTGCC
TCAGCTGGAGCGAAGAGGAGGGGATCGGCCTGGCGTTTGACTGGCTACAGGGAGACTGCGTATGA