SecReT6
Protein ID: 401764634
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15880
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3392328..3393017 [-]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDJ7GN52
KEGG IDeno:ECENHK_15880
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-38, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|401764634|ref|YP_006579641.1| DotU family type IV/VI secretion system protein [Enterobacter cloacae subsp. cloacae ENHKU01]
MNERKHGTAVSVDIDALLQDTWLQVISLRHGPLFLEGEGRALWERCIADVERVQRELKASELDETSCQHI
LSAQCALLDEAVKGRGVEDDACVQWYDIPLQGHFLGTMDAGDTLCDKMRDVLREPAPDCAVLTCFQRVMM
LGFLGNFRSLNDPERQKLVTALNERVAPFSYPQTHPVLAESRVGRGMGGWLESWSMRIGLSVVVLAALWW
GLDHWLDQLLQSLLPGVVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3393017-3392328 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGAATGAACGTAAACATGGCACTGCCGTGTCAGTGGATATTGATGCTTTGCTGCAGGATACCTGGCTTC
AGGTTATCAGCCTTCGCCATGGTCCCCTGTTTCTGGAGGGAGAAGGGCGGGCTCTGTGGGAGCGCTGTAT
CGCGGATGTGGAGCGCGTTCAGCGTGAACTGAAAGCCAGTGAGCTGGATGAGACCAGTTGTCAGCATATC
CTCTCCGCTCAATGTGCATTGCTTGATGAGGCGGTCAAAGGTCGTGGTGTGGAGGACGATGCCTGTGTGC
AGTGGTATGACATACCGCTGCAGGGGCATTTTCTTGGCACAATGGATGCGGGTGACACCCTGTGCGACAA
GATGCGCGATGTGCTGCGTGAGCCAGCACCAGACTGCGCCGTGCTGACCTGCTTCCAGCGAGTCATGATG
CTGGGTTTTCTGGGGAACTTCCGCTCGCTAAACGATCCGGAACGTCAGAAGCTCGTCACAGCCCTGAATG
AACGGGTGGCGCCGTTTAGCTATCCGCAGACGCATCCTGTGCTGGCAGAGAGCCGTGTCGGTCGGGGAAT
GGGAGGTTGGCTTGAATCATGGTCCATGCGTATTGGCCTTAGTGTGGTGGTTCTTGCTGCGCTCTGGTGG
GGGCTGGATCATTGGCTCGATCAACTGCTGCAGTCCTTGTTGCCGGGAGTCGTAAAATGA