SecReT6
Protein ID: 401764635
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15885
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3393014..3394354 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDJ7GIL6
KEGG IDeno:ECENHK_15885
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.80E-133, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|401764635|ref|YP_006579642.1| type VI secretion protein [Enterobacter cloacae subsp. cloacae ENHKU01]
MKTEQPLWGRGILVSPQHFQQQVAYAAWSAECIARLGLSCPWGVIDAIFEPESLKLGRIQARHLHVRFQD
GTLIDTDNADPLPPVLSLESESQEVTVVLALPLLRANGGNCLKPDEVAERPVRYRQSWRDVRNAFGEDTR
QIAVMHPELTLRFDHQNNSDYLTCPVARLQQDSQGSWQLDETFLPPLLTIQGSRWLVTQLEQLLTQLRVR
LCRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFQRNLQSPPERLYPELSRLAGSLLTFSLE
HQVSAIPVWQHEQLNAVFPPLFDLLGDLLEASLPSRVVALSLDYDPRLHFWQARLHDPRLREGADYYLSV
RSPIPVAQLQEQFPRQCKVGSPDHVRGIVNSSRVGVPLTPLRHVPAAIPLRLENQYFSLDLSHPLATEML
QSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3394354-3393014 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGAAAACGGAACAACCGTTATGGGGCAGGGGCATTCTGGTCTCTCCCCAGCATTTTCAGCAACAGGTCG
CGTATGCGGCCTGGTCTGCGGAATGTATTGCCCGACTGGGTCTTTCGTGCCCGTGGGGGGTCATTGATGC
CATCTTTGAACCGGAATCTCTCAAACTAGGGCGTATTCAGGCCCGGCATCTGCACGTCCGTTTCCAGGAC
GGCACGCTGATTGATACCGACAATGCTGATCCTCTGCCGCCGGTGCTGTCGCTTGAGAGTGAATCACAGG
AGGTGACGGTGGTGCTGGCGCTTCCGCTGCTGCGGGCGAACGGCGGCAACTGTTTAAAGCCTGATGAAGT
CGCTGAGCGTCCGGTGCGATATCGCCAGAGCTGGCGGGATGTTCGCAATGCCTTTGGTGAGGATACCCGT
CAGATTGCGGTGATGCATCCGGAGCTGACGCTGCGTTTTGATCATCAGAATAACAGCGATTATCTGACTT
GCCCTGTCGCCCGACTGCAGCAAGATTCACAGGGTTCATGGCAATTAGATGAGACGTTTCTCCCTCCTCT
GTTGACGATCCAGGGCAGCCGCTGGCTGGTGACTCAACTGGAACAGCTGTTGACCCAGCTGCGAGTTCGC
CTCTGCCGTCTGATGGCAATGCGTCGTGAAAGCAATGAGCGCATGGCTGATTTCGCCGTGGCGGATGTAT
CTCTGTTCTGGCTGCTCAACGCGCTGAACAGTGCCGAGCCTGTGCTTGGTCAGTTCCAGCGTAACCTGCA
AAGCCCGCCGGAACGTCTGTATCCGGAACTTTCTCGCCTGGCCGGGAGCCTGCTGACCTTCTCTCTGGAG
CACCAGGTGAGCGCCATACCTGTCTGGCAGCACGAGCAACTCAATGCGGTATTTCCACCGCTGTTTGATT
TGCTTGGCGACCTGCTTGAAGCCAGCCTGCCGTCCCGCGTGGTGGCTCTGTCACTCGACTATGACCCACG
GCTGCACTTCTGGCAGGCGCGTCTGCATGACCCACGTCTGCGTGAAGGGGCTGATTACTACCTTTCCGTG
CGTTCACCGATACCGGTTGCCCAACTGCAGGAACAGTTTCCGCGCCAGTGTAAGGTGGGCAGTCCTGACC
ATGTGCGGGGGATCGTCAACTCTTCACGTGTGGGCGTACCGTTAACCCCACTGCGCCATGTGCCAGCCGC
CATTCCATTGCGCCTGGAAAACCAGTATTTCAGTCTCGATCTTTCCCATCCTCTGGCGACAGAAATGCTC
CAGAGCGGAACATGCATGTTTTACGTCCCGGGCATGCTTGGCGAGCCTGAACTTGAACTCTTTGCGGTAC
TGCGAACATGA