SecReT6
Protein ID: 401764636
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15890
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3394371..3395915 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDJ7GE37
KEGG IDeno:ECENHK_15890
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.50E-174, Aligned region: 88..510
Protein Sequence: 514 a.a.     [Download]
>gi|401764636|ref|YP_006579643.1| EvpB family type VI secretion protein [Enterobacter cloacae subsp. cloacae ENHKU01]
MLMSVQNNIAGGESMVLERPAAGGVYASLFEKINLSPVSELSALDIWQDAQAMSDATADERLTAGMQVFL
ECLTKAGAKVEKLDKSLIDHHIAELDYQISRQLDAVMHHEEFQAVEGLWRGVKSLIDKTDFRQNVKIELL
SMSKEDLRQDFEDSPEIIQSGLYKHTYIDEYDTPGGEPIAALISAYEFDASAQDVALLRNISKVSAAAHM
PFIGSAGPKFFLKESMEDVAAIKDIGNYFDRAEYIKWKSFRDTDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEEVKGPDHDKYLWTNASFAFASNMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSSQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLYA
IPHFQVEGMDVNLSLVSQMPKAKS
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3395915-3394371 Enterobacter cloacae subsp. cloacae ENHKU01 chromosome, complete genome
ATGCTCATGTCTGTACAAAATAATATTGCTGGCGGTGAAAGCATGGTGCTGGAACGTCCTGCTGCGGGTG
GGGTTTACGCCTCCCTGTTTGAGAAAATCAACTTAAGTCCCGTCTCTGAATTGAGCGCCCTGGATATCTG
GCAGGACGCGCAGGCGATGTCGGATGCGACCGCTGATGAACGTCTGACGGCAGGTATGCAGGTCTTCCTG
GAATGTCTGACCAAAGCCGGTGCGAAAGTCGAAAAACTGGATAAAAGCCTGATTGATCACCACATTGCTG
AACTCGATTACCAGATCAGCCGTCAGCTGGACGCGGTAATGCACCATGAGGAGTTTCAGGCAGTTGAAGG
TCTGTGGCGCGGAGTGAAGTCGCTGATTGATAAAACAGATTTTCGCCAGAACGTGAAAATTGAGTTGCTG
AGTATGTCTAAAGAAGACCTGCGTCAGGACTTCGAAGACAGCCCGGAAATCATCCAGAGTGGCCTGTATA
AACACACCTATATTGATGAATATGATACCCCAGGCGGCGAGCCAATTGCGGCACTGATTTCCGCATACGA
GTTCGATGCTTCAGCGCAGGATGTCGCGCTGCTGCGCAACATCTCTAAAGTCTCCGCTGCTGCGCACATG
CCGTTTATCGGCTCAGCAGGTCCAAAATTCTTCCTTAAAGAGTCCATGGAAGACGTCGCTGCGATAAAAG
ATATTGGTAACTATTTTGACCGCGCAGAGTACATCAAGTGGAAATCGTTCCGCGATACCGACGACGCTCG
CTATATCGGCCTGGTCATGCCGCGCGTACTGGGACGTTTACCGTACGGGCCAGATACCGTTCCCGTTCGC
AGCTTCAATTATGTCGAAGAGGTCAAAGGTCCGGATCACGACAAATACCTGTGGACGAATGCCTCCTTTG
CCTTTGCGTCCAACATGGTGCGTAGCTTTATCAATAATGGCTGGTGCGTACAGATTCGTGGTCCGCAGGC
CGGTGGTGCGGTTCAGGACCTGCCTATCCATCTTTACGATCTCGGTACCGGCAATCAGGTAAAAATCCCG
AGTGAGGTCATGATCCCCGAAACCCGCGAATTTGAGTTTGCGAATCTGGGCTTCATTCCTTTGTCCTACT
ACAAAAACCGCGACTATGCCTGCTTCTTCTCGGCTAACTCAAGCCAGAAACCGGCGCTGTATGACACCGC
AGATGCAACGGCTAACAGCCGCATCAACGCGCGTCTGCCGTATATCTTCCTGCTGTCGCGTATCGCCCAT
TACCTGAAGCTGATTCAGCGCGAAAACATCGGTACCACGAAGGATCGCCGTCTGCTTGAACTGGAGCTGA
ATACCTGGGTTCGCAGTCTGGTCACTGAAATGACCGATCCGGGCGATGAACTGCAGGCGTCTCACCCGCT
GCGTGATGCGAAAGTGGTTGTCGAAGATATTGAAGACAACCCGGGCTTCTTCCGCGTGAAGCTGTACGCG
ATCCCTCACTTCCAGGTCGAAGGCATGGACGTCAACCTGTCACTGGTTTCCCAGATGCCGAAGGCGAAAT
CGTAA