SecReT6
Protein ID: 401764637
SecReT6 ID687
T6SS typei2
Gene symbol-
Locus tagECENHK_15895
StrainEnterobacter cloacae subsp. cloacae ENHKU01
Repliconchromosome [GenBank: NC_018405] [Browse all T6SS(s) in this replicon]
Location [Strand]3395948..3396445 [-]
Producthypothetical protein
NoteTssB
UniProt IDJ7GKS3
KEGG IDeno:ECENHK_15895
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.90E-52, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|401764637|ref|YP_006579644.1| hypothetical protein ECENHK_15895 [Enterobacter cloacae subsp. cloacae ENHKU01] [TssB]
MSDSFQNEVPKARINLKLDLHTGGASKKMELPLKLLVAGDFSNGQDAAPISEREKVNITKNNFDSVLSEY
SPKVNLSVKNTLSDDGGEDNIELTFQSMKDFTPEQVAAQIPQLKAMLAMRNLLRDLKANLLDNQTFRKEL
EKIVLDQSLSAELRNELSALAPKKA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|401761514|ref|NC_018405.1|:c3396445-3395948 Enterobacter kobei, complete sequence [TssB]
ATGTCTGACAGTTTTCAGAATGAAGTGCCTAAGGCACGTATTAACCTGAAGCTTGACCTGCATACTGGCG
GAGCAAGCAAGAAAATGGAATTACCCTTAAAACTGCTTGTTGCCGGTGATTTCAGTAATGGTCAGGATGC
TGCGCCAATATCTGAGCGTGAAAAAGTTAATATCACCAAAAATAATTTCGACAGTGTTCTTTCCGAATAT
TCCCCAAAAGTTAATCTGAGCGTCAAAAACACACTGTCAGATGATGGTGGTGAGGACAATATTGAGCTGA
CTTTCCAGAGCATGAAAGATTTCACGCCAGAGCAGGTGGCTGCCCAGATACCACAGCTGAAGGCGATGCT
GGCGATGCGCAACTTACTCCGCGATCTTAAGGCCAACCTGTTGGATAACCAGACTTTCCGAAAAGAGCTG
GAAAAAATCGTTCTTGACCAGTCGCTTAGCGCTGAATTGCGCAATGAATTATCCGCACTGGCACCCAAAA
AAGCTTAA