SecReT6
Protein ID: 402567781
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3036
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3319791..3320747 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDJ7J5F1, J7J5F1
KEGG IDbct:GEM_3036
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.30E-26, Aligned region: 152..184
OmpA [PF00691], Evalue: 2.30E-26, Aligned region: 216..310
BON [PF04972], Evalue: 2.10E-05, Aligned region: 90..127
BON [PF04972], Evalue: 2.10E-05, Aligned region: 162..183
Protein Sequence: 318 a.a.     [Download]
>gi|402567781|ref|YP_006617126.1| OmpA/MotB domain-containing protein [Burkholderia cepacia GG4]
MQRTIHVRLTRVSPFVAGLVTAGLIASGAAYAQNTGGATVTPVGNGTVATAALPANTNANPGTAPATASG
TVVHGTAGTITPPPTNAAPGQVVVGGKVPDEATKAAVLQKLRDTYGAANVVDQIEVGDVATPPNWSANVQ
KLLGAQLKQISKGQLKINGTQIEMKGEVHNEAQRQQLASDMANTLNPTYTIRNGLRVSASEQGLLDQTLA
NRTIEFETGSATLTPQGRQILDQMAAALSKMQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKS
IPPQQMTTTGVGPDQPIAPNDTADGRARNRRIEFRVGQ
 
Nucleotide Sequence: 957 bp     [Download]
>gi|402564811|ref|NC_018513.1|:3319791-3320747 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGCAACGCACGATTCACGTCCGGCTCACGCGCGTCTCGCCCTTCGTTGCCGGCCTCGTCACCGCCGGCC
TCATCGCCAGCGGTGCGGCCTACGCGCAGAACACGGGCGGCGCGACCGTCACGCCGGTCGGCAACGGCAC
GGTCGCGACCGCCGCCCTGCCCGCGAATACGAACGCGAACCCCGGCACCGCGCCGGCCACGGCATCGGGC
ACGGTGGTGCACGGCACCGCCGGCACGATCACGCCGCCGCCCACGAACGCGGCGCCCGGCCAGGTCGTGG
TCGGCGGCAAGGTGCCCGACGAGGCGACCAAGGCCGCCGTGCTGCAGAAGCTGCGCGACACCTACGGCGC
GGCGAACGTGGTCGACCAGATCGAGGTCGGCGACGTCGCGACACCGCCGAACTGGAGCGCGAACGTGCAG
AAGCTGCTCGGCGCGCAGCTCAAGCAGATCAGCAAGGGCCAGCTGAAGATCAACGGCACGCAGATCGAGA
TGAAGGGCGAGGTGCACAACGAGGCGCAGCGCCAGCAGCTCGCGAGCGACATGGCGAACACGCTGAACCC
GACGTACACGATCAGGAACGGGCTGCGCGTGTCGGCGTCCGAGCAGGGCCTGCTCGACCAGACGCTCGCG
AACCGCACGATCGAGTTCGAGACGGGCAGCGCGACGCTGACGCCGCAAGGCAGGCAGATTCTCGACCAGA
TGGCGGCCGCGCTGTCGAAGATGCAGAACCGCACGGTCGACATCATCGGCCACACCGACAACTCGGGGAA
CCGAACGTCGAACATCGCGCTGAGCCAGGCGCGCGCGGACGCGGTGAAGGGCTACCTGATCACGAAGAGC
ATCCCGCCGCAGCAAATGACGACGACGGGTGTCGGACCGGATCAGCCGATCGCGCCGAACGACACGGCCG
ACGGGCGGGCCCGCAACCGGCGCATCGAGTTCCGGGTCGGGCAGTAA