SecReT6
Protein ID: 402567782
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3037
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3320825..3321946 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDJ7JDR4
KEGG IDbct:GEM_3037
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.00E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|402567782|ref|YP_006617127.1| type VI secretion-associated protein, ImpA family [Burkholderia cepacia GG4]
MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRYDDPTLDQGEWVTEIKEADWGFVVDHAGALLRTR
TKDLRLAVWLTEALALEDGITGLTEGYALLEGLCRDYWDTVHPLPEGDDVEYRLGNVAWLSGRTAELLRG
IPVTEGASNAFTTLDWEVAQHVAQAVKRDPEHADDIARGKPSVEQIDASRRVTPIAFYAGLLANLKAFEI
ALDAFEERLVERAGNSAPSFRQTRDAFETVYRLAERFAREQGYTGSAPHAPAAPQAQPERIEPSFGDAFH
TEETHVQSQTAPRPPVTQMIAGIQNRAQAVDQLRSVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVKPDEQS
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c3321946-3320825 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGCCGATCAATCTCCCCGAGCTGCTGACGCCGATCAGCGATGCGTCGCCCAGCGGCGACGACCTGCTGT
TCTCGAACGAATTCGACGCGATCCAGGACGCGCGCCGCTATGACGATCCGACGCTCGACCAGGGCGAGTG
GGTAACCGAGATCAAGGAGGCCGACTGGGGCTTCGTCGTCGATCATGCGGGCGCGCTGCTGCGCACCCGC
ACCAAGGACCTGCGGCTCGCCGTGTGGCTGACCGAGGCGCTCGCGCTGGAGGACGGCATCACCGGCCTCA
CCGAAGGCTATGCGCTGCTGGAAGGGCTGTGCCGCGACTACTGGGACACCGTGCATCCGCTGCCCGAAGG
CGACGATGTCGAATACCGGCTCGGCAACGTCGCCTGGCTGTCCGGGCGCACGGCCGAACTTCTGCGCGGC
ATTCCGGTGACGGAAGGCGCGTCGAACGCGTTCACCACACTCGACTGGGAAGTCGCGCAGCACGTTGCGC
AGGCCGTGAAGCGCGACCCCGAGCACGCGGACGACATCGCGCGCGGCAAGCCGTCGGTCGAACAGATCGA
TGCGTCGCGGCGCGTGACGCCGATCGCGTTCTATGCCGGACTGCTCGCGAACCTGAAGGCATTCGAAATC
GCGCTCGACGCGTTCGAGGAGCGGCTCGTCGAACGCGCGGGCAATTCGGCGCCGAGCTTCCGGCAGACGC
GCGACGCATTCGAGACCGTATACCGGCTCGCCGAGCGCTTTGCGCGCGAGCAGGGCTATACGGGCAGCGC
GCCGCATGCGCCGGCGGCGCCGCAGGCGCAGCCCGAGCGTATCGAGCCGAGCTTCGGCGATGCGTTCCAC
ACCGAGGAGACCCACGTGCAGTCGCAGACCGCTCCGCGTCCGCCGGTGACGCAGATGATCGCCGGCATCC
AGAACCGTGCGCAGGCCGTCGACCAGCTGCGTTCGGTCGCACGCTATTTCCGCCAGACCGAGCCGCACAG
CCCGGTCGCGTATCTCGCCGACAAGGCGGCCGAATGGGCCGACATGCCGCTGCACAAGTGGCTCGAGAGC
GTCGTGAAGGACGACGGCTCGCTGTCGCATATTCGCGAGCTGCTCGGCGTGAAGCCCGACGAGCAGTCGT
AA