SecReT6
Protein ID: 402567784
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3039
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3324700..3325800 [-]
Producttype VI secretion system protein
NoteTssG
UniProt IDJ7J5Z3
KEGG IDbct:GEM_3039
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.80E-95, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|402567784|ref|YP_006617129.1| type VI secretion system protein [Burkholderia cepacia GG4]
MQAPNRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPGAWRQGDVVAQRIEFRNTLSLGFPPS
EIEGVRSFDDDGTLLDSGEQRGAALAAGELGHVELTPAFFGLLGGQGALPLHYTEQIVAREHLKRDHAAR
AFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAIAGVPSDEVRDSLAAGAGGVLDEAVAGYA
LAARHRPMSAAYLQRTLSDYFRVPVKIDQFVGKWYDVPPDQLSVLGEVNAVLGATALVGERVWQRDMRAR
IVVGPLSKRDYEAFLPGGAQAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRD
AVDDRSDARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c3325800-3324700 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGCAAGCCCCGAACCGGCGAATCGATCCTGGCGTAGTCGACGCGCTGCTCGACGAGCCGCACCGCTTCG
AGTTCTTCCAGGCGGTGCGCGTGCTCGAAGGGCTGTTCGCGCGGCAGGCGTCCGATGCGCCCGGCGCGTG
GCGGCAGGGCGACGTCGTCGCGCAGCGCATCGAATTCCGCAACACGCTGTCGCTCGGCTTCCCGCCGAGC
GAGATCGAGGGCGTCCGCTCGTTCGACGACGACGGCACGCTGCTCGATTCCGGTGAGCAGCGCGGCGCCG
CGCTCGCGGCCGGCGAGCTCGGTCATGTCGAACTGACGCCCGCGTTCTTCGGGCTGCTGGGCGGGCAGGG
CGCACTGCCGCTGCACTACACCGAGCAGATCGTCGCGCGCGAGCACCTGAAGCGCGACCATGCGGCGCGC
GCGTTCTTCGACGTGTTCTCGAACCGCGCGACCGCGCTGTTCTACGCAGCGTGGAAGAAATACCGGCTGC
CGTTCCATTACGAACTCGACCGCGACGAGCGCTACCTGCCGCTCCTGCTCGCGATCGCCGGCGTGCCGAG
CGACGAGGTGCGCGACAGCCTCGCGGCCGGCGCGGGCGGCGTGCTCGACGAGGCGGTTGCCGGCTACGCA
CTCGCCGCGCGGCACCGGCCGATGTCGGCCGCGTACCTGCAGCGCACGCTGTCCGACTACTTCCGCGTGC
CGGTGAAGATCGACCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGACCAGCTGAGCGTGCTCGGCGA
GGTCAACGCGGTGCTCGGCGCGACGGCGCTGGTCGGCGAACGCGTGTGGCAGCGCGACATGCGCGCGCGG
ATCGTCGTCGGCCCGCTATCCAAGCGCGACTACGAGGCATTCCTGCCCGGCGGCGCGCAGGCCGTCGCGC
TCGAACGGATGCTGACGCTGCTTGCGGGCGTCACGCTCGAATACGAGGTCAAGCTCGTGCTGAAGCGCAC
CGAGGTCGGCGCGAGTGTGCTCGGCGCCGGCTCGCGGCTCGGCTGGGACGCGTTCCTCTGCACGCGCGAC
GCGGTCGACGACCGCTCGGATGCCCGCTACGAGCTGCACGTGATTCACTGA