SecReT6
Protein ID: 402567785
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3040
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3325764..3327599 [-]
Producttype VI secretion system protein
NoteTssF
UniProt IDJ7JEP6
KEGG IDbct:GEM_3040
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-216, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|402567785|ref|YP_006617130.1| type VI secretion system protein [Burkholderia cepacia GG4]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIDRGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARYTPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLSTLRAHLHGEQSFVAALTDCLFVHVLGA
YVEPERNGRWTALRKLPIAQAGFDEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDLAAIARASGRC
QRATLHLVLQDVRSDSHVARLLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPAMLAFGLEGGDLFQDGGAQTSGISLLRRPTQSVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFV
GASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c3327599-3325764 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAGCGCGAATTATCGTTTTTGCGGCGCTATTCGCGGGATTTCGCCG
AACGTTATCCGAAGATCGCGGCGCGGCTCGCGTTGTCCGGCGAGCACTGCGAGGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTCGGCGCGCGCATCAACAAGAAGCTCGACGACGACTACCCCGAATTC
ACCGAAGCGCTGCTGGAAGTGCTGTATCCGCACTACCTGCGGCCGTTCCCGTCGTGCTCGATCGCGCAGT
TCACGCCGGCTTCGCCCGGCCAGCAGACCGAACCGGTCGTGATCGACCGCGGCACCGAGCTGAAGAGCCG
CCCGATCCGCGGCGTACAGTGCCGGTTCCGCACCGCATACGACGTGACGCTGGCGCCGATCCGCATCTCG
GAGGCGCGCTACACGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCCAACGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTCGCCGCGCAGCTCGATCTCGGCGCGCTGAAGCTGTCGACGCTGCGTGC
GCACCTGCACGGCGAACAGTCGTTCGTCGCCGCGCTGACCGACTGCCTGTTCGTCCACGTGCTCGGCGCG
TATGTCGAGCCGGAGCGCAACGGCCGCTGGACCGCGCTGCGCAAGCTGCCGATCGCGCAGGCCGGCTTCG
ACGAGGACGACGCGCTGATCGACTACCCGGCGAAGTCGCACCCCGCGTATCGCCTGCTCACCGAATACTT
CGCGTTCCCCGACAAGTTCGATTTCGTCGATTTCGACCTCGCGGCGATCGCGCGCGCGTCGGGCCGCTGC
CAGCGCGCGACGTTGCATCTGGTGCTGCAGGACGTGCGCAGCGATTCGCACGTCGCGCGGCTGCTCGAGT
TGCTGACGGCCAGCCATTTCCGGCTGTTCTGCACGCCGATCGTCAACCTGTTCCGCCAGCACGGCGAACC
GATCCGCATCACGCACCGCGCGGTGTCGTACCCGGTGATCGCCGAAGCGCGCCGCGCGTTCGCGTACGAG
GTGTACTCGATCGATTCGGTGAAGCTCGTCCGGCAGCAGGCGCATGAAGAATCGGTGATCGAGTTCCGGC
CGTTCTATTCGCTGCATCACGGCGAATCGGCACGGATCGGTCATTACTGGTTCGCGCGCCGCAACGACTG
GGTCGCGCAGAAGAGCCCCGGCTACGAAACCGAGATCTCGATCGTCGACATCGACTTCGAACCGACGTCG
CCGCAGACCGACACCCTGAGCCTCGACCTCACCTGCACGAACCGCGACCTGCCGGCGATGCTCGCGTTCG
GCCTCGAGGGCGGCGATCTGTTCCAGGACGGCGGAGCGCAGACGAGCGGCATCTCGCTGCTGCGGCGCCC
GACGCAAAGCGTGCGCTTCGAGCGCGGCCGCGCCGCGCACTGGCGGCTTGTGTCGCATCTCGCGCTGAAC
CACGTGTCGCTGGTCGCGCACGGGCTCGCACCGCTCAAGGAAATGCTGACGCTGTACGACCTGCGGCGCA
CCGCCGTGTCGATGCGCCAGATCGACGGCTTGGCCGGCGTCGAGCAGCGCGGCGCCGTGCAGTGGCTGCC
CGGCAAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATCCGGCTGACGATCGACGAGGAACACTTCGTC
GGTGCGAGCCTCGCGTCGTTCGTGCGCGTGCTCGACAGCTTCTTCGGGCTGTACGTCCATCTCAACAGTT
TCGTTCAATTGGTCGTCGTGTCGAAGCGCACCGGCGAGGAGATCATCCGATGCAAGCCCCGAACCGGCGA
ATCGATCCTGGCGTAG