SecReT6
Protein ID: 402567786
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3041
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3327677..3328162 [-]
Producttype VI secretion system protein TssE
NoteTssE
UniProt IDJ7J5F5
KEGG IDbct:GEM_3041
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|402567786|ref|YP_006617131.1| type VI secretion system protein TssE [Burkholderia cepacia GG4]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNTRIAHTESELAALPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQSTNALYFAIQALLVVHPAEEPVNFD
AMLQPSTLQYSVTRARAARML
 
Nucleotide Sequence: 486 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c3328162-3327677 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGAAACGATTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCACCTGCCGGCCTCGGCAG
CGATGCGGCAATTGTCGCTGGACGAGCTCAAGAACACGGTCGCCCGCGACGTCGAGGCGATCCTCAACAC
CCGTATCGCGCACACCGAGAGCGAGCTGGCCGCGCTGCCGGAATGCCAGAAGTCGGTGCTGACCTACGGG
CTGAACGATTTCGCGGGGCTGAGCCTCGCGAGCCACTACGACCGCGCGTTCATCTGCAAGTCGATCCAGC
AGGCCATCGCGCGCCACGAGCCGCGGCTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGTCGAC
CAACGCGCTGTACTTCGCAATCCAGGCGCTGCTCGTCGTGCACCCGGCCGAAGAGCCGGTGAATTTCGAC
GCGATGCTGCAGCCGTCGACGCTGCAGTATTCGGTCACGCGCGCACGCGCCGCAAGAATGCTGTAA