SecReT6
Protein ID: 402567787
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3042
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3328225..3328728 [-]
Producttype VI secretion system protein
NoteTssD
UniProt IDJ7JDR9
KEGG IDbct:GEM_3042
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-43, Aligned region: 7..139
Protein Sequence: 167 a.a.     [Download]
>gi|402567787|ref|YP_006617132.1| type VI secretion system protein [Burkholderia cepacia GG4]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c3328728-3328225 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGTTACATATGCACTTGCAGTTTGGTAGTCCGGCGGTGAAGGGCGAATCCGCGGACAAAGACCATCAGG
GCTGGATCGAACTGAAATCGTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACGGCATCGACCGCAGG
CGGTCACACGATGACGCGCTGCGAACACGGCGACATGATTTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTACCAGCACGCATCGGGCGGCACCACGTTCGATGAAGTGACGGTCCATTTCTCGCGCGCGGATG
GCGAAGGCAAGCGCGTGCAGTATCTGGAAGTGAAGCTCAAGTACGTGATCATCTCGAGCATCGCACCGAG
CGTTCGCGAAGAAGGTCTGCCGCTCGAGACGTTCTCGCTGAAGTACGCAGCCGTGCAGTGGAAGCAGACC
CAACAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA