SecReT6
Protein ID: 402567788
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3043
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3328799..3330289 [-]
Producttype VI secretion protein
NoteTssC
UniProt IDJ7JAP7
KEGG IDbct:GEM_3043
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.10E-190, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|402567788|ref|YP_006617133.1| type VI secretion protein [Burkholderia cepacia GG4]
MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISTQLSAVMHAPEFQRLESTWRGMDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGK
PRDLGKVFDTVEYAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTEHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGRPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c3330289-3328799 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAAGCGAGCGGCGCGGAATACGCCGCCGGGACTTCACTGCTCGACG
ATATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGCGCGAAGGACCTGATCGGCGA
ACTCGTGCACCAGGTGCTCGACGGCACGGTGATCGTGTCGGACAACCTGTCGGCGACGATCGATGCGCGT
GTCGCGGAACTCGACCGCCTGATCTCCACGCAGCTGTCCGCGGTGATGCACGCGCCGGAATTCCAGCGCC
TCGAAAGCACGTGGCGCGGGATGGACTACCTGGTCAAGGAAAGCAACACCGGCCAGACGATCAAGATCAA
GGCGCTGCACGCACCGAAGCGCGACCTCGTGCGCGACTTCAAGGGCGCGAGCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAAGAGTTCGGCACGTTCGGCGGTTCGCCGTTCGGTGCGCTGATCGGCG
ACTACGAGATCTCGCGCCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCACGTCGCGGCGGCCGC
GCACGCGCCGTTCATCGCGTCGGCGTCGCCGGAGCTGCTCGGCCTCGAGTCGTTCTCCGACCTCGGCAAG
CCGCGCGACCTCGGCAAGGTGTTCGACACGGTCGAGTACGCGAAGTGGAAGTCGTTCCGCGATGCCGAGG
ATTCCCGCTACGTCGGCCTCACGCTGCCGCGCTTCCTCGGGCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACCGCGGAGAATTTCAACTTCGTCGAGGACGTCGACGGCACCGAACACGACAAGTACCTGTGGTGCAAC
GCGGCGTGGGCATTCGCGGCACGCCTGACGGCCGCGTTCGACGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGACCTGCCGACCCACACGTTCAAGACCGACGACGGTGAAGTCGC
GCTGAAGTGCCCGACCGAAATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTCGTCCATTGCAAGAACTCGGATTACGCTGCGTTTTTCGCCGCGCAATCGGTGCAGAAACCGAAAA
AATACAGCACCGACAGCGCGAATGCGAACGCCGTCCTGTCCGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGTGTCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCATCGGCGCAGAACGTG
GAGACTTTCCTCAACCGGTGGATTTCGCAGTACGTCCTGCTCGACGACAACGCATCGCAGGAACAGAAGG
CGCAATTCCCGCTGCGCGAGGCATCCATACAAGTGTCGGAGATTCCGGGCAGGCCGGGCTCGTATCGTTC
GGTCGCGTTCCTGCGCCCGCACTTTCAGCTCGACGAACTCTCGATTTCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA