SecReT6
Protein ID: 402567789
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3044
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3330305..3330820 [-]
Producttype VI secretion system protein
NoteTssB
UniProt IDJ7J5Z7
KEGG IDbct:GEM_3044
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.10E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|402567789|ref|YP_006617134.1| type VI secretion system protein [Burkholderia cepacia GG4]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSPDGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSDVLKNTQQLQELAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|402564811|ref|NC_018513.1|:c3330820-3330305 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGGCCAAGAAAGAAAGCATTCAGAAAAGCTTGCAGAAAATACGGCCGCCGCGCGTCCAGCTGACCTACG
AGGTCGAGAAGGGCGACGCGATCGAGGTGAAGGAACTGCCGTTCGTCGTCGGGGTGGTCGGCGATCTGGC
GGGCCAGTCGGAAGTCGAGCAGCCGAAGCTGCGCGATCGCAAGTTCGTCAACATCGACCGTGACAACTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCCGCGTTCCAGGTGGAAAACCGCCTGAGCCCGGACGGCG
GCAAGTTCGCCGTCGACCTGAAGTTCCGTTCGCTGTCGGATTTCAGCCCGGACGAAGTCGTCGAACAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCCGACCTGCGCAACAAGCTCGCCGGCAAC
GACAAGCTCGAGGATCTGCTGTCCGACGTGCTGAAGAACACGCAGCAGCTGCAAGAGCTCGCGAAGGGCA
CGGGCGGCGACAAAGACGGCGAATGA