SecReT6
Protein ID: 402567791
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3046
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3331894..3332493 [+]
Producttype VI secretion system protein
NoteTssJ
UniProt IDJ7J5F9
KEGG IDbct:GEM_3046
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-37, Aligned region: 11..171
Protein Sequence: 199 a.a.     [Download]
>gi|402567791|ref|YP_006617136.1| type VI secretion system protein [Burkholderia cepacia GG4]
MIRYALPLIACALLAGCAAAPLLGSAASAVMQAAGVGKPDLPDAQKPPRNIGLTLAAAPNLNAATDRKPL
ALVVRLYALKDPTSFQQAPFDAFTDPTKEKAALGADLLNVREITLIPGQRYTATEKVSREAQAFGIVALF
RDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTDGSVIAPQQGAPSQPLNMLSSVTCG
 
Nucleotide Sequence: 600 bp     [Download]
>gi|402564811|ref|NC_018513.1|:3331894-3332493 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGATTCGCTATGCGCTGCCACTGATTGCCTGCGCGCTCCTGGCCGGATGCGCGGCCGCCCCGTTGCTCG
GCTCTGCCGCGAGCGCCGTGATGCAGGCCGCCGGCGTCGGCAAGCCTGATCTGCCGGATGCCCAGAAGCC
GCCGCGCAATATCGGACTCACGCTCGCCGCCGCGCCCAACCTGAATGCCGCGACCGATCGCAAACCGCTC
GCATTAGTAGTAAGGCTCTACGCGCTGAAGGATCCGACGTCGTTCCAGCAGGCACCGTTCGACGCGTTCA
CCGATCCGACCAAGGAAAAAGCCGCACTGGGCGCCGATCTGTTGAACGTGCGTGAGATCACGCTGATTCC
CGGCCAGCGTTATACGGCGACCGAAAAGGTATCGCGCGAAGCGCAGGCATTCGGCATTGTCGCGCTGTTC
CGCGATCCCGCACTCCAGCGATGGAAACTGACGTTCGACCCGGCGAAGTCGGAGAAATCCGGCATAATCA
TCGGCCTGCATAATTGCGCGATGACGGTCACCGATGGTTCTGTCATTGCACCGCAACAGGGTGCACCTTC
GCAACCGCTGAATATGCTTTCGTCGGTCACCTGCGGTTAA