SecReT6
Protein ID: 402567792
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3047
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3332596..3333942 [+]
Producttype VI secretion system protein
NoteTssK
UniProt IDJ7JDS4
KEGG IDbct:GEM_3047
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-134, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|402567792|ref|YP_006617137.1| type VI secretion system protein [Burkholderia cepacia GG4]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVLRVAELALVFP
DGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFMTRFVSEQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYTLADLPVYRHDDPGPSFARLDVMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFSLDSRGALYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|402564811|ref|NC_018513.1|:3332596-3333942 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTTTGGGGAGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAGCGGCAGG
ACGCGTACCACGAGGCGCGCCTGTTCGAGTCCATCCAGGCGATCCAGCCTTACAACTGGGGCGTGCGCTC
GGTGCGCATCGACCGCGACGCGCTCGGCAGCAATGTGCTGCGCGTGGCGGAACTCGCACTCGTGTTCCCG
GACGGCGCGCTGTACGCTGCGCCGCAGGCCGACGACCTGCCGCCTCCGATCGCGCTGGACACGCTGCCCG
ACGGCATCAACGAATTCGTGTTCTATCTCGCGCTGCACCCGCTGCGCGAGAACGGCACCAATTACAGCGA
CGATCCGGCCGCCGGCTTCATGACGCGTTTCGTCAGCGAGCAGACGAGCGTCGCGGACAACTTCACCGAC
GCCGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAACCGCGCGACC
AGCTGCTGTCGGTGCCGCTCGTGCGCGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACAGCTT
CGTGCCGCCGTGCCTCGCGATCGAGGCGTCGCCGATCCTGCACCAGCGGCTGCGCCAGCTGGTCGACGCG
CTGCAGGCGAAGGTCAACGCGCTGTACGGTTTCCACCGCGAGCCGTCGAAGAACATCATCGAATTCCGCT
CGGGCGACATCGCATCGTTCTGGCTGCTGCACACCGCGAACGCCGCATTCGCGACGCTCGCGCACCTGCA
CCAGCACGCGGCGCTGCATCCGGAGCGGCTGTTCCAGGAACTGCTGCGCCTCGCGGGCCAGCTGATGACG
TTCTCGAAGGGCTACACGCTCGCCGACCTGCCCGTGTATCGCCATGACGATCCGGGCCCGAGCTTCGCGC
GTCTCGACGTGATGCTGCGCGAACTGCTCGACACCGTGATCTCGACGCGTTACTTCGCGATCACGCTCGA
CGAGGTGCGTCCGTCGTTCCATCTCGGCCGCCTCGACTCGGGCAAGATCGACGACAAGACCGAGTTCTAT
CTGGCGGTGTCCGCGGACATGCCGAGCGTCGAGCTCGTCGATGCGGTGCCGGCCCGCTTCAAGGTCGGCG
CGCCCGACGACGTCGACAAGCTCGTGCTGTCGGCAATGCCCGGCGTGCGGCTCTCGTACACGCCGCAGGT
GCCGCCCGCGATCCCCGTGCGGCCGGGCGCGTGCTACTTCTCGCTCGATTCGCGCGGCGCGCTGTACGAA
CGCATGCTGCAGGCCCAGTCCGCGATGATCTACGCGCCGACTGGCATCAACGACCTGAAATTCGAACTGA
TCGCGGTCACATCATGA