SecReT6
Protein ID: 402567793
SecReT6 ID688
T6SS typei4b
Gene symbol-
Locus tagGEM_3048
StrainBurkholderia cepacia GG4
Repliconchromosome I [GenBank: NC_018513] [Browse all T6SS(s) in this replicon]
Location [Strand]3333939..3334721 [+]
Producttransmembrane protein
NoteTssL
UniProt IDJ7JAQ1
KEGG IDbct:GEM_3048
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-57, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|402567793|ref|YP_006617138.1| transmembrane protein [Burkholderia cepacia GG4]
MSYAPSLFGDNAPAPLHTPASTDAAFQARSLLDLLYDGFFMLFLLKNGRAPDSASEFSTKIQEFLSDFER
GAKKLNIAAEDVYSAKFAYCAAVDEMVLSSQFKIRADWERRPLQLVLFGEQLAGEKFFQYLEDCRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAPFAPHWPLPDQIAHRLKREVPVW
AIGAVFALVALLGYLGLNTYLKDKTLQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|402564811|ref|NC_018513.1|:3333939-3334721 Burkholderia cepacia GG4 chromosome 1, complete sequence
ATGAGCTACGCGCCTTCCCTGTTCGGCGACAACGCGCCGGCCCCGCTGCATACCCCGGCGTCGACCGACG
CCGCGTTCCAGGCCCGTTCGCTGCTCGACCTGCTGTACGACGGGTTCTTCATGCTGTTCCTGCTCAAGAA
CGGCCGCGCGCCCGACAGCGCGAGCGAGTTCAGCACGAAGATCCAGGAATTCCTGTCGGATTTCGAGCGC
GGCGCAAAGAAGCTGAACATCGCGGCCGAGGATGTCTACAGCGCGAAGTTCGCGTATTGCGCGGCCGTCG
ACGAAATGGTGCTGTCGTCGCAGTTCAAGATTCGCGCCGACTGGGAACGCCGGCCGCTGCAGCTCGTGCT
GTTCGGCGAGCAGCTCGCGGGCGAGAAGTTCTTCCAGTATCTCGAGGATTGCCGCGCGCAGGGCGCGGCG
CGGCTGCAGTCGCTCGAAGTGTTCCACATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTCGAAG
GGCCGGAGAAGCTCGCGTATCTGACCGCGCGGCTCGGCGATGAAATCGCGCACATGAAGGGCAAGCGCGC
GCCGTTCGCGCCGCACTGGCCGCTGCCGGACCAGATCGCGCACCGGTTGAAGCGCGAAGTGCCGGTATGG
GCGATCGGTGCCGTGTTCGCGCTCGTCGCGCTGCTCGGGTATCTCGGGCTAAACACGTACCTGAAGGACA
AGACGCTGCAGGCGCTTGCACCGTATTCGCAGGTGATCAAGGTCGGGCCGGAGTCGGCGAACCTGACGAT
TTCGCTGCCTTGA