SecReT6
Protein ID: 402780221
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1965
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2116458..2117828 [+]
Producthypothetical protein
NoteTssK
UniProt IDK4H3F8
KEGG IDkpp:A79E_1965
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.70E-124, Aligned region: 27..453
Protein Sequence: 456 a.a.     [Download]
>gi|402780221|ref|YP_006635767.1| hypothetical protein A79E_1965 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MKAKGTGGAMKIFRPLWRDGAFLVPQQFQQQARWDAHVADTVSRMALAHPWGVLRAEFDASALTLSRLNA
TRLIVRFADGTLIDTELADILPPVRDVSDVMQDSVEVLLALPLLSASGGNLDDGQESARPRRWRAEQVTV
QELAGHERSELAVLRHALTLRLSTEENAAFLTCPVARLVRDAQGQWIVDPEFIPPLLSLAASPTLVSELG
ELLHRLQARRRRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLSELHQDPSRHPELLYRELARLA
GSLLTFSLEHHLEAIPRYRHASPEQVFPPLFALLDTLLEVSLPSRVIAIALEQGADREIWRGRLHDARLR
EGAEFLICRCALHYPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALD
LSTDAARAMLEAGNCTFYTPESLGDVKLELFAVLRS
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2116458-2117828 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGAAAGCGAAAGGCACAGGAGGTGCAATGAAGATTTTCCGCCCATTATGGCGCGACGGGGCTTTTCTGG
TCCCGCAGCAGTTTCAGCAACAGGCCCGCTGGGACGCGCACGTCGCCGATACGGTCTCCCGCATGGCTCT
CGCCCACCCGTGGGGGGTATTGCGCGCGGAGTTTGACGCGAGCGCGCTCACCCTTTCCCGGCTCAACGCT
ACCCGGCTGATCGTGCGTTTCGCCGACGGAACGCTGATTGACACCGAGCTGGCGGATATTTTGCCACCGG
TCCGCGATGTATCGGACGTGATGCAGGACAGCGTGGAGGTTCTGCTCGCTCTGCCGCTGCTCAGCGCCAG
CGGCGGCAATCTTGATGACGGCCAGGAGAGCGCCCGCCCGCGCCGCTGGCGCGCCGAGCAGGTGACCGTC
CAGGAGCTGGCCGGCCATGAACGCAGCGAGCTGGCCGTTCTGCGGCACGCGCTAACGCTGCGTCTCTCCA
CCGAGGAAAATGCAGCCTTTCTCACCTGCCCGGTAGCGCGTCTGGTGCGCGACGCCCAGGGGCAGTGGAT
CGTTGACCCGGAATTCATCCCGCCGCTGCTGTCGCTGGCGGCAAGCCCGACGCTGGTCAGCGAGCTGGGC
GAGCTGTTACATCGCCTGCAGGCCCGACGCAGACGCCTGATGGCCATGCGTCGTGAAAGCAATGCGCGGA
TGGCTGATTTTGCCGTGGCGGATGTTTCCCTGTTCTGGCTGCTCAACGCGCTGAACAGCGCTGAACCGGT
GCTCAGCGAGCTGCATCAGGACCCTTCGCGCCATCCGGAGCTGCTCTATCGCGAACTGGCCAGGCTGGCC
GGCAGTCTGCTGACTTTCTCCCTTGAACATCATCTGGAAGCAATCCCCCGCTACCGGCATGCCTCGCCAG
AGCAGGTATTCCCGCCGCTGTTTGCCCTGCTGGATACGCTGCTCGAAGTCAGCCTGCCCTCAAGGGTGAT
CGCCATCGCTCTGGAGCAGGGCGCCGACCGGGAGATCTGGCGGGGCAGGCTGCACGATGCGCGGCTGCGC
GAGGGGGCGGAGTTTTTAATCTGTCGGTGCGCTCTTCACTACCCCCCTCACCAGCTACAGAGCCGCTTTC
CGCAGCTCTGTAAGGCGGGTAGCCATGATGATGTCGCCGAGGTCGTCAATATTGCCCTCAGCGGCATCGC
GATCAAACCGCTGAGCCATGTGCCGGCGGCCATTCCGCTACGTCTGGAAAACCAATATTTCGCTCTGGAT
CTCTCCACCGACGCCGCCCGCGCGATGCTGGAGGCCGGCAACTGCACCTTCTATACCCCGGAATCGCTTG
GCGACGTGAAACTTGAACTCTTTGCGGTACTGCGCTCATGA