SecReT6
Protein ID: 402780222
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1966
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2117825..2118478 [+]
Producttransmembrane protein
NoteTssL
UniProt IDK4H2E9
KEGG IDkpp:A79E_1966
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-41, Aligned region: 10..205
Protein Sequence: 217 a.a.     [Download]
>gi|402780222|ref|YP_006635768.1| transmembrane protein [Klebsiella pneumoniae subsp. pneumoniae 1084]
MNTSESDLINKTFYPGWLMVSQLRCGQPVTDGEALYRQACRWVTEAREALTAGGVSEASAEQMLYAYCAL
LDESVLNRASQDDGYRRWRKDPLQARFFSTLNAGEELWERIRQLLREPTADAAVLTCFFRTLQLGFVGQY
RAEDDERREDVAQALGARVPPFSLTQEAPVVVRASRLRSGRRMYWCGWAAGIVALAALWLTCSAMLSQMV
AQIAGQG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2117825-2118478 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGAATACCTCTGAAAGCGATCTGATCAACAAAACTTTTTACCCGGGCTGGCTGATGGTCAGCCAGTTAC
GCTGCGGCCAGCCGGTGACGGATGGCGAGGCGCTCTATCGCCAGGCCTGTCGATGGGTGACCGAGGCGCG
CGAGGCGCTGACGGCGGGGGGAGTCAGTGAAGCCAGCGCTGAGCAGATGCTCTATGCCTACTGCGCGCTG
CTGGATGAGAGCGTCCTCAACCGCGCCAGTCAGGATGATGGCTACCGCAGGTGGCGCAAGGATCCGCTGC
AGGCGCGCTTTTTCAGCACTCTCAACGCCGGGGAAGAGCTCTGGGAACGGATCCGCCAGCTGCTGCGAGA
GCCCACGGCGGATGCGGCAGTGCTGACCTGCTTCTTTCGTACTTTACAGCTGGGATTTGTCGGACAGTAC
CGCGCCGAGGATGACGAACGGCGTGAGGACGTGGCGCAAGCGCTTGGCGCGCGGGTCCCGCCGTTCAGCC
TGACCCAGGAGGCGCCGGTGGTGGTTCGTGCCTCCCGGCTGCGCAGCGGACGGCGGATGTACTGGTGCGG
CTGGGCGGCTGGCATTGTGGCGCTGGCGGCGCTGTGGTTGACCTGCTCCGCCATGCTGTCACAGATGGTG
GCGCAGATAGCAGGGCAGGGATAA