SecReT6
Protein ID: 402780223
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1967
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2118482..2120179 [+]
Productouter membrane protein
NoteTagL
UniProt IDK4HD34, K4HD34
KEGG IDkpp:A79E_1967
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.40E-17, Aligned region: 435..531
DUF4381 [PF14316], Evalue: 0.0062, Aligned region: 23..61
Protein Sequence: 565 a.a.     [Download]
>gi|402780223|ref|YP_006635769.1| outer membrane protein [Klebsiella pneumoniae subsp. pneumoniae 1084]
MRDNARRLLTILTVILALWLVLGFWPLSIGNQVIFSLCILLAGGAALWRQRRRAVSRQRSEIVLPPEDFQ
GAVVLVCGDTDGLFPGRSAHGETRHGWYLRGDSAEQLPGLAQYLAAARPALVSQVSVLLAVVPEHHPSGE
HLAQSLRDWRRSIVQCRTWLNGLPPVWSVFWVTPPGGQAGESRWFTITPERPGLQVQQKGQAPQAVAGWQ
REGSPASRLHQTLWLESILTLAENALFRPFRARQAELPPLNLCAAGICLTPVAAVANNLWQQQIAAITTL
SPGNDAAPGPHPLPDLLLSSLPHRHGVSRRMRDAGLSAGVGFLFLALAMLASFINNQRLVRSVGDHLAVY
HRLSGTPPTPKLQAQQRLRADSRLLDDWLRRGEPLRYRLGLYQGGRLIPFVEAAINDWAPPPPPRPVIKQ
VVQGPQTIRLDSMALFDTGKSALKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDRSNQQLSLKRAE
AVRDWMRDTGDVPESCFAVQGYGASRPVASNETPEGRAQNRRVEISLVPQKDACLTPGTANTSGVETNGL
KSETE
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2118482-2120179 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGCGTGATAACGCTCGTCGTCTGCTTACGATACTGACCGTCATCCTGGCCCTGTGGCTAGTGCTGGGCT
TCTGGCCGCTGTCCATCGGCAACCAGGTGATCTTCAGTCTGTGCATCCTGCTGGCGGGCGGCGCGGCGCT
CTGGCGTCAGCGTCGCCGGGCAGTCAGCCGTCAGCGATCGGAAATCGTCCTGCCGCCCGAGGATTTTCAG
GGGGCAGTGGTTCTGGTCTGCGGGGATACCGACGGTCTGTTTCCCGGGCGTTCGGCGCACGGCGAAACCC
GTCACGGCTGGTATCTACGGGGAGACAGCGCGGAGCAATTGCCGGGGCTGGCGCAGTACCTGGCGGCGGC
GCGTCCGGCACTGGTATCGCAGGTTTCCGTGCTGCTGGCGGTGGTACCGGAGCACCACCCCTCCGGGGAG
CATCTGGCGCAGTCGCTGCGCGACTGGCGGCGGAGTATCGTTCAGTGCCGAACCTGGCTAAACGGTCTGC
CGCCGGTGTGGAGCGTGTTCTGGGTGACGCCGCCAGGCGGCCAGGCAGGGGAAAGCCGCTGGTTTACCAT
CACGCCGGAGAGGCCTGGGCTCCAGGTGCAGCAGAAGGGACAAGCGCCCCAGGCGGTTGCCGGGTGGCAG
CGGGAGGGCAGCCCTGCCTCACGCCTGCATCAGACGCTGTGGCTGGAGAGCATTCTGACCTTGGCCGAAA
ACGCTCTTTTCCGGCCATTCCGCGCCCGGCAGGCGGAACTTCCTCCGCTGAACCTGTGTGCCGCGGGCAT
CTGCCTGACACCGGTAGCGGCGGTGGCGAATAACCTCTGGCAACAGCAAATCGCCGCGATCACCACGCTC
TCCCCGGGCAACGACGCGGCGCCAGGTCCTCACCCGCTGCCGGATCTTCTTCTGTCGTCACTGCCGCACC
GCCACGGGGTCAGCCGCCGGATGCGCGATGCCGGTCTTTCCGCTGGGGTGGGCTTCCTCTTTCTGGCGCT
GGCGATGCTGGCTTCCTTTATCAACAACCAGCGCCTGGTGCGCAGCGTCGGCGATCATCTGGCGGTGTAC
CACCGCCTCAGCGGCACGCCGCCGACGCCGAAGCTGCAGGCGCAGCAGCGTCTGCGTGCCGACAGCCGCC
TGCTGGATGACTGGTTGCGCCGGGGGGAGCCGCTGCGTTATCGGCTGGGGCTGTATCAGGGGGGGCGGCT
GATCCCCTTCGTGGAAGCCGCTATCAATGACTGGGCGCCGCCCCCGCCGCCGCGTCCGGTCATTAAGCAG
GTTGTGCAGGGGCCGCAGACGATCCGCCTCGATAGCATGGCGCTGTTCGATACCGGCAAATCGGCGCTGA
AACCGGGTTCGACAAAGCTGCTGGTGAACTCGCTGCTGGGCATTAAGGCCAAACCCGGCTGGCTGATCGT
GGTGGCAGGCCATACCGACAGCATCGGCAACGATAGATCCAATCAACAACTCTCCCTGAAGCGTGCCGAG
GCGGTCCGCGACTGGATGCGCGATACCGGCGATGTGCCGGAGAGCTGTTTTGCGGTGCAGGGCTACGGCG
CAAGCCGTCCTGTCGCCAGCAACGAGACGCCAGAGGGGCGGGCGCAAAATCGCCGGGTGGAGATCAGTCT
GGTCCCGCAGAAGGACGCCTGTCTGACGCCGGGCACGGCCAATACCTCAGGAGTAGAGACTAACGGATTA
AAAAGCGAAACCGAGTAA