SecReT6
Protein ID: 402780224
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1968
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2120638..2123124 [+]
ProductVgrG protein
NoteTssI
UniProt IDK4H6S5
KEGG IDkpp:A79E_1968
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.90E-64, Aligned region: 35..355
Phage_GPD [PF05954], Evalue: 7.90E-64, Aligned region: 753..781
DUF2345 [PF10106], Evalue: 1.00E-54, Aligned region: 605..759
T6SS_Vgr [PF13296], Evalue: 4.20E-33, Aligned region: 487..593
Phage_base_V [PF04717], Evalue: 1.50E-15, Aligned region: 387..482
Protein Sequence: 828 a.a.     [Download]
>gi|402780224|ref|YP_006635770.1| VgrG protein [Klebsiella pneumoniae subsp. pneumoniae 1084]
MDTSSIITGTTLNRYQLDIPSCTASLDVEEFSGAEKLSELYYYTITFTSAEKNIDAAQLLSKPAMLTMGG
GALQQLADCKRVHGVVTAFRRISSSEDQSKYQITLEPFLSLLDKQFRSHRFFVNKSVPEVVEQVLQEHHL
HDWEYEFYLKQHYPRREQINQYQESDLAFIQRLLAEVGIFYFFTLQEEAQSEVVHFADAQRALMFDKTLP
VNSPSGMSDSGAESIWGLSITHNVVEANVTTRDYNPRDAQSVLQSATADMTRGNGEGITYGEVYHYKLRH
RERGDKIDPQTETANFYARLDHERFLAHQTLITAISTAAWLAPAQVLTVTDSLPSTLPAPVQDPLLITGT
GFTASRREALRVSLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKANDIYAWQDASGLYRVKFDPDRD
EKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDPVTEKNSTRNV
IRTPTNNKLRMEDKRGEEHIKLSTEYGGKTQLNLGHNVNAQRELRGEGAELRTDKWVSIRGGAGVFISAD
KQPSAGDRMLAMEEAIAQLENALGIAKSLASAAESAQALPSDTGNQQTLNDALKELAQPGIVLNAPQGVS
ISSPQAVRLSSGSASVGIVSQQNTDISALKRFTVAAGEAVSLLARKAGMKLFAAKGKIEIQAQDDALEAT
AKKDITVTSVEGRVEITAAEELVVNCAGAYIRLSGGNIELGCPGNILLKSANVQKMGAADYDANKPELPV
GFSEFFTAKDEESGEILPFTRYRITTGEGKVFEGRTDAEGKTVAVYTALPDALHIELL
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2120638-2123124 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGGATACCTCTTCAATAATTACCGGCACCACCCTTAACCGTTACCAGCTGGATATTCCTTCATGTACCG
CATCGCTGGATGTGGAAGAATTCAGTGGGGCAGAAAAACTGAGTGAACTTTATTATTACACTATTACGTT
TACCAGCGCAGAGAAAAATATTGATGCCGCACAGCTCCTGAGCAAACCCGCCATGCTGACGATGGGCGGC
GGCGCACTGCAGCAGCTGGCGGACTGCAAACGCGTCCATGGCGTGGTGACTGCCTTCCGGCGTATCAGCA
GTTCAGAAGATCAGTCGAAATATCAGATAACCCTCGAACCCTTCCTCTCCTTACTGGATAAACAGTTTCG
CAGCCACCGTTTTTTCGTGAATAAATCGGTGCCGGAGGTGGTGGAGCAGGTATTGCAGGAACATCACCTG
CATGACTGGGAGTATGAGTTTTATCTCAAGCAACACTATCCACGGCGCGAGCAAATTAATCAGTATCAGG
AGAGCGACCTGGCATTTATCCAGCGCCTGCTGGCAGAGGTGGGGATATTTTATTTCTTCACCCTGCAGGA
AGAGGCGCAGAGCGAAGTGGTTCACTTCGCCGACGCGCAGCGGGCGCTGATGTTCGATAAGACACTTCCT
GTAAACAGCCCGTCCGGGATGAGCGACAGCGGTGCGGAATCGATATGGGGTCTGAGCATCACCCACAACG
TCGTAGAGGCGAACGTTACTACCCGGGATTATAACCCCCGCGATGCGCAGAGCGTTCTCCAGTCGGCAAC
AGCGGATATGACCCGGGGAAATGGTGAAGGCATCACTTACGGTGAGGTATACCACTATAAGCTTCGCCAC
CGGGAGCGTGGCGATAAAATCGACCCGCAGACGGAGACCGCCAACTTCTATGCCCGCCTCGACCATGAGC
GTTTTCTGGCTCACCAGACGCTTATTACCGCGATCAGTACTGCAGCCTGGCTGGCGCCGGCCCAGGTGCT
GACCGTTACCGACAGCCTGCCGTCGACCCTGCCTGCGCCCGTACAGGATCCGCTGTTAATCACCGGCACC
GGTTTTACCGCCAGCCGCCGGGAGGCGCTGCGGGTGTCCCTGCTGGCGGTGCCCTACAGCGAAACATTGT
GCTGGCGTCCGCCGCTGCTGCCGCGCCCGAAGGTGACTGGCACCATGACGGCGCGGGTGACCAGCGCGAA
AGCGAATGATATCTACGCCTGGCAGGATGCGTCCGGCCTGTACCGGGTGAAATTTGACCCTGACAGAGAT
GAGAAAGGGCAGGGGCAGGAAAGCATGCCGGTGCGTCTCGCCAAACCCTACGGCGGCGACGTGTACGGCT
TTCACTTCCCGCTGATCCAGGGCACGGAGGTGGCGATTGCTTTCCACGAAGGCGACCCTGACCGGCCGTA
TATTGCGCATGCGCTGCACGACTCGCGGCATGTCGATCCTGTGACGGAGAAAAACAGCACCCGCAATGTG
ATTCGTACTCCGACCAACAATAAGCTGCGAATGGAGGATAAGCGCGGCGAGGAGCATATCAAGCTCAGCA
CCGAGTACGGCGGCAAGACGCAGTTGAACCTGGGGCATAACGTGAATGCGCAGAGGGAGTTGCGGGGCGA
GGGTGCGGAACTGCGTACGGATAAATGGGTGAGCATCCGGGGCGGTGCGGGAGTGTTTATCAGTGCGGAT
AAACAGCCTTCGGCAGGCGACAGGATGCTGGCAATGGAGGAGGCGATTGCGCAGCTTGAAAATGCCCTGG
GTATTGCGAAAAGCCTGGCGTCGGCAGCGGAATCGGCTCAGGCCCTGCCATCGGATACCGGCAACCAGCA
GACGCTGAACGATGCGCTGAAAGAGCTGGCGCAGCCGGGGATAGTGCTGAATGCGCCGCAGGGCGTGAGC
ATCAGCAGTCCGCAGGCGGTACGGTTGTCTTCGGGTAGCGCCAGCGTGGGGATTGTGTCACAGCAGAATA
CGGACATTAGTGCGCTGAAACGTTTTACGGTGGCGGCGGGAGAAGCCGTCAGCCTGCTGGCGCGAAAGGC
GGGGATGAAGCTGTTTGCGGCGAAGGGAAAGATTGAAATCCAGGCGCAGGATGATGCGCTGGAGGCGACG
GCGAAAAAGGATATCACCGTGACCAGCGTGGAAGGGCGAGTGGAAATCACGGCGGCGGAGGAACTGGTGG
TGAATTGTGCGGGAGCGTATATCAGGCTAAGTGGTGGCAATATCGAGCTGGGCTGCCCTGGGAATATTCT
GCTGAAATCGGCCAATGTGCAGAAAATGGGCGCAGCTGATTATGATGCAAACAAACCTGAGCTTCCCGTC
GGTTTCAGTGAGTTTTTTACTGCAAAAGATGAAGAGTCCGGGGAGATTTTACCTTTTACCCGGTACAGGA
TAACAACCGGTGAAGGTAAAGTATTTGAAGGCAGGACCGATGCGGAAGGTAAAACTGTTGCAGTTTATAC
TGCCCTGCCTGATGCCCTGCATATAGAATTACTTTAA