SecReT6
Protein ID: 402780236
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1981
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2130756..2131022 [+]
Producthypothetical protein
NotePAAR
UniProt IDK4H3G9
KEGG IDkpp:A79E_1981
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.60E-23, Aligned region: 9..81
Protein Sequence: 88 a.a.     [Download]
>gi|402780236|ref|YP_006635782.1| hypothetical protein A79E_1981 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MSKGFVLLGDKTTHGGAVISASSTMIVNGKPVALVGDKVSCPIPGHGTNAIIEGAPEWSSDGKAIVVDGC
KCQCGCQVISGAPECAIG
 
Nucleotide Sequence: 267 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2130756-2131022 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGTCCAAAGGTTTTGTATTACTCGGCGATAAAACCACGCACGGCGGTGCTGTTATTTCCGCATCCTCCA
CCATGATTGTAAATGGAAAGCCCGTAGCGCTGGTGGGGGATAAAGTCAGCTGCCCGATTCCGGGACATGG
CACTAATGCCATTATTGAGGGAGCGCCGGAATGGTCTTCCGATGGTAAAGCCATCGTGGTCGATGGCTGC
AAATGTCAGTGCGGTTGCCAGGTGATTTCCGGCGCGCCGGAATGCGCGATAGGATAA