SecReT6
Protein ID: 402780239
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1984
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2135711..2137474 [+]
Productprotein ImpG/VasA
NoteTssF
UniProt IDK4H6T6
KEGG IDkpp:A79E_1984
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-183, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|402780239|ref|YP_006635785.1| protein ImpG/VasA [Klebsiella pneumoniae subsp. pneumoniae 1084]
MDDLTLRYFDAEMRYLREAAKAFAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKIAETVPAGFEISSRPLGPKNTVCRYRTTRDLTLNPLA
IDEAMMTAEPDGRSALRLRFACSELAGWSQTDLRRLALYLGEDAVTGSALHLWLTRRQAALYLRLPGQTE
RVSLDGYFSPGGFSEEDRLWPKGESAFSGYQLLLEYFTFREKFMFVQLNGLENITLPAGISHFTLEVVFS
EVWQSDLPVSASSLRLHCVPVINLFTLEADPLTISGLESEYLLRPKRLQDGHTEIYSVDSVTGSGRTGEA
RYVPFTRFRHQGGMMRRHAPERYYHTRVKRGVTGMHDTWLILGGQQWEADRELARETVSLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCRPTLPAYPPAEDRYHWRVMSHLGTRFLNMMSSAEVLRGTLSLYN
WREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGDVHLFGDMLNRFFALYADMNQ
FNQLTLIVQPEGKCIRWKENHSLRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2135711-2137474 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGGACGATTTAACCCTGCGATATTTTGACGCTGAAATGCGCTACCTGCGCGAGGCGGCAAAAGCGTTCG
CGCAGGCTCACCCCGATCGGGCGGCGATGCTGGATCTCGATAAAGCCGGTACGCCGGACCCTTACGTTGA
GCGCCTGTTTGAAGGCTTTGCCTTTTCCGTTGGTCGCTTGCGCGAAAAAATTGATGATGATCTGCCGGAG
CTGACCGAGGGGCTGGTCAGCATGCTGTGGCCGCACTATTTGCGCACCATTCCGTCGTTATCGATCGTGG
CGCTGACCCCAACGCTGCCGGCGATGAAGATAGCGGAAACGGTGCCCGCCGGGTTTGAGATTAGCTCCCG
CCCACTGGGGCCGAAAAATACCGTGTGCCGGTACCGAACCACCCGCGATCTGACGCTTAACCCGCTGGCG
ATAGATGAGGCGATGATGACGGCGGAGCCGGATGGGCGTTCGGCCCTGCGACTACGATTCGCCTGTAGCG
AGCTGGCTGGCTGGTCGCAGACCGATCTCCGCCGCCTGGCGCTGTACCTGGGGGAAGACGCCGTTACCGG
CAGCGCCCTCCATCTGTGGCTGACCCGACGCCAGGCCGCGCTGTACCTGCGTCTGCCGGGTCAGACAGAG
CGGGTAAGCCTCGACGGCTATTTTTCCCCGGGGGGATTCAGCGAGGAGGATCGTTTATGGCCGAAGGGGG
AGAGCGCTTTCAGCGGCTATCAGCTGCTGCTCGAGTATTTCACCTTTCGCGAAAAATTTATGTTCGTGCA
GCTAAATGGCCTGGAAAACATCACCCTGCCGGCGGGGATATCGCATTTCACGCTTGAGGTGGTGTTCAGC
GAGGTCTGGCAAAGTGATTTACCCGTCAGCGCAAGCAGCCTGCGCCTGCACTGTGTGCCGGTGATTAACC
TGTTTACCCTTGAGGCCGATCCGTTGACCATCAGCGGGCTGGAGAGCGAATACCTCCTGCGTCCGAAGCG
CCTGCAGGACGGGCATACCGAAATCTATTCTGTCGACAGCGTGACCGGCTCCGGGCGCACCGGGGAGGCG
CGCTATGTGCCTTTCACCCGCTTTCGTCACCAGGGCGGGATGATGCGTCGCCATGCTCCTGAGCGCTACT
ACCACACCCGCGTAAAACGGGGCGTAACCGGCATGCACGATACCTGGCTTATCCTCGGCGGACAGCAATG
GGAGGCTGACCGGGAGCTGGCGCGGGAAACGGTCTCCTTGCGCATCACCGGCACTAACGGCCAGCTGCCG
CGCCGGGCGCTACAGAGCACGCTGCTGGATCGCTGTGAGTCGATATCAGCCACGCCGCTTACCGTCCGCA
ATCTCTGTAGGCCCACGCTGCCGGCCTATCCCCCGGCGGAAGACCGCTACCACTGGCGGGTCATGAGCCA
TCTGGGCACCCGTTTTCTCAACATGATGAGCAGCGCCGAGGTGCTGCGCGGCACGCTGTCGCTCTACAAC
TGGCGGGAGGATGAGCTCAATAATCGCCGTCTGGACGCCATTCTGGCGGTCAGCCATCACCGAATTCAGC
GTTTCGAGCAGGGCTTCCTGCTGCGCGGGCTGGATATCGAAGTGACGCTCGACGGTAGCGGATTTACCGG
TGCGGGCGATGTCCACCTGTTTGGCGATATGCTCAACCGCTTTTTCGCACTATATGCCGATATGAATCAG
TTCAACCAGCTGACGCTCATTGTTCAACCTGAAGGGAAATGTATCCGGTGGAAAGAGAATCACAGTCTGC
GCCTGCCCGGCTGA