SecReT6
Protein ID: 402780240
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1985
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2137429..2138520 [+]
Producthypothetical protein
NoteTssG
UniProt IDK4H234
KEGG IDkpp:A79E_1985
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.10E-82, Aligned region: 23..324
Protein Sequence: 363 a.a.     [Download]
>gi|402780240|ref|YP_006635786.1| hypothetical protein A79E_1985 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MYPVERESQSAPARLMAQLRPQLPYMNFYRFCQLLEKNHPKAPIIGSGWLVGDEPIRFRPHPGMGFPAGE
IRGMDDPEPPRPPAVRVTFMGLYGVESPLPTHYSDDIAQRREGVEATEDFLDIFNHRLIAQYYRIWRKYS
YPATFRAGGTDNISQYLLGLAGLGIPGCAAVAASPLSRFLALLPVMMLPGRSGEGMEALVALLAPGTRAT
VYHHDPCRIPLSQPLTMSVRQPVSLQHRPVMGTHATDVNGQVLLQLATEKPDEVRGWLPGGELFSDLMAL
LHVWLGSHLDVRLQLCVARHLLPDAQLCCQQEHAVQLGRTAVLRPLDAQKQADDRVTIYLGRYQRVRENI
HRRESDEDGDYRS
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2137429-2138520 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGTATCCGGTGGAAAGAGAATCACAGTCTGCGCCTGCCCGGCTGATGGCGCAGCTCCGGCCTCAGTTGC
CGTACATGAATTTTTACCGCTTCTGCCAGTTGCTGGAGAAGAACCATCCGAAGGCGCCGATCATCGGCAG
CGGCTGGCTAGTAGGTGATGAACCCATACGCTTTCGCCCGCATCCGGGGATGGGCTTTCCGGCTGGTGAA
ATCCGTGGAATGGACGATCCTGAACCGCCCCGTCCGCCGGCGGTTCGCGTGACTTTTATGGGACTCTACG
GCGTGGAATCCCCGCTGCCGACCCACTATAGCGATGACATTGCGCAACGGCGGGAAGGCGTCGAGGCCAC
CGAGGATTTCCTCGATATCTTTAACCATCGGCTGATCGCCCAGTATTACCGTATATGGCGCAAATATTCC
TACCCGGCAACCTTTCGGGCGGGCGGCACGGACAACATCTCGCAGTATCTGCTGGGCCTGGCGGGGCTGG
GCATACCGGGATGTGCCGCCGTTGCCGCATCGCCGCTGTCGCGATTTCTGGCGCTGCTGCCGGTGATGAT
GCTGCCGGGGAGATCCGGGGAAGGCATGGAGGCGCTGGTGGCGCTCCTGGCCCCGGGGACCCGGGCGACG
GTGTACCACCACGATCCCTGCCGGATCCCCTTGTCGCAGCCGTTAACGATGAGCGTCCGTCAGCCGGTTA
GCCTGCAACATAGGCCAGTGATGGGAACCCACGCCACGGATGTGAACGGTCAGGTATTGCTGCAGCTGGC
CACGGAAAAGCCTGATGAGGTTCGCGGCTGGCTGCCCGGCGGCGAACTGTTCAGCGACCTGATGGCGCTT
CTGCACGTCTGGCTCGGATCTCATCTTGACGTGCGGCTGCAGCTTTGCGTCGCCCGCCATTTACTGCCGG
ATGCGCAACTTTGCTGCCAGCAGGAGCATGCCGTCCAGCTCGGCCGTACCGCTGTGCTGCGTCCTCTGGA
TGCGCAGAAACAGGCTGACGACAGAGTCACGATTTATCTGGGGCGCTATCAGCGCGTCCGGGAAAATATC
CACCGCAGGGAGAGCGATGAAGATGGCGATTACCGCAGTTAA