SecReT6
Protein ID: 402780241
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1986
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2138549..2139037 [+]
Producthypothetical protein
NoteTssJ
UniProt IDK4H3H3
KEGG IDkpp:A79E_1986
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-38, Aligned region: 3..153
Protein Sequence: 162 a.a.     [Download]
>gi|402780241|ref|YP_006635787.1| hypothetical protein A79E_1986 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MVTVLTGCGLTQTVKDGAVSVTQSIFYPQVKTLHLDLRAREGVNNNAKGASLATVVRIYQLKDRQAFDNT
DYPSLFAGDGQALQADRVAEKDVRLRPGESVTVDMPMETSAQFVAVAAMFIDPDLTQNSWRLVLTRDELD
PARPRIIEASQNQLTLHPFKEK
 
Nucleotide Sequence: 489 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2138549-2139037 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGGTTACCGTCTTAACCGGCTGCGGACTGACGCAGACCGTGAAAGACGGTGCCGTTTCCGTGACCCAGT
CCATTTTTTACCCCCAGGTGAAAACCCTGCATCTGGATCTTCGCGCCCGGGAAGGCGTGAATAACAACGC
CAAAGGCGCCTCCCTGGCGACGGTGGTGCGTATTTATCAGCTGAAGGACCGGCAAGCGTTCGACAATACT
GACTACCCGTCGCTGTTTGCCGGCGATGGCCAGGCGCTGCAGGCGGACCGGGTGGCGGAAAAAGATGTTC
GCCTGCGTCCGGGCGAATCGGTGACCGTCGATATGCCCATGGAAACCAGCGCGCAGTTTGTGGCGGTGGC
GGCCATGTTTATCGATCCAGACCTGACGCAAAACAGCTGGCGGCTGGTACTCACCCGGGACGAACTTGAT
CCGGCGAGGCCGCGCATTATCGAAGCCAGCCAAAATCAACTGACGCTGCACCCGTTTAAGGAGAAGTGA