SecReT6
Protein ID: 402780242
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1987
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2139040..2139483 [+]
Producthypothetical protein
NoteTssE
UniProt IDK4H2G5
KEGG IDkpp:A79E_1987
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-16, Aligned region: 26..113
Protein Sequence: 147 a.a.     [Download]
>gi|402780242|ref|YP_006635788.1| hypothetical protein A79E_1987 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MPRPSLYDILYGNFAGGLDLNTVSETDQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTAVLQGMPASA
HQLMSTLSAVLLKYEPRLQRIAVVMLDQHAPGELRYAIDAELKDIGLVRYGTEFMPEGRVLIRHLKRQQY
LDARSAL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2139040-2139483 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGCCTCGTCCCTCCCTGTATGACATCCTGTACGGCAATTTCGCCGGCGGGCTTGACCTGAATACTGTCA
GCGAAACGGATCAGGTCATCCTGTCGGTGCTCGATAACATGCAGCGCATCCTCAACTGTCGGGCCGGAAC
GCTGGCGCATCTGCCGGACTACGGCCTGCCGGATATGACCGCTGTCCTCCAGGGGATGCCAGCGTCGGCG
CACCAGCTGATGAGCACGTTGTCGGCGGTGTTGCTGAAATACGAACCGCGCCTGCAGCGGATCGCGGTGG
TGATGCTCGATCAGCATGCGCCCGGCGAACTGCGCTATGCCATTGATGCGGAGCTGAAGGATATTGGCCT
GGTGCGTTACGGCACGGAGTTTATGCCCGAGGGCAGGGTGTTGATCCGCCACCTCAAACGTCAGCAGTAC
CTTGACGCCCGCTCCGCCCTCTAA