SecReT6
Protein ID: 402780243
SecReT6 ID690
T6SS typeN/A
Gene symbol-
Locus tagA79E_1988
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2139503..2140918 [+]
Producthypothetical protein
NoteTssA
UniProt IDK4HD41
KEGG IDkpp:A79E_1988
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.00E-51, Aligned region: 36..61
DUF3702 [PF12486], Evalue: 3.00E-51, Aligned region: 90..178
DUF3702 [PF12486], Evalue: 3.00E-51, Aligned region: 303..447
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 324..340
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 356..374
Protein Sequence: 471 a.a.     [Download]
>gi|402780243|ref|YP_006635789.1| hypothetical protein A79E_1988 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MMTTHHDRHYKAGGDPRTLADFMALRAEMNKLSHPARPDINWPYAEQLARGLLEHHGADLQTVAWYTLAR
ARLGGVAGINEGLTLMESLLVRQGKNLWPQALPARTEIFRTLSKRLRQVIRTLNLTPEDVESLEQAERSL
QSFDAVLQRLEIAPENQLSDLRALLHSTATRFESLDPAPALPTAPPVAVSDAELPGTLVSEEDAAKVEPV
PDLKRRPKAEPLAPPSPAKRPAPVAASTPAAAPRWKPFIAGMVTMLAVTGIAVGGWLALRQSDLPPISVT
QNAGPIPGLPATTPPGPVDLPQTQRQLGELARLAPDWAVSYGDQLVHQALIRWPDQAQPLAQQWRQQLSA
GALPAENLTGWSEGMQQLQRLADQLNALDEQKGKYLTVSELKTAVFAITQSFNRAVPLEEQLRQLAALPV
DQPWPAARGSLAELHLQQLIVEYALLKRKQPASPTAALPATGEPSVSEAVK
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|402778297|ref|NC_018522.1|:2139503-2140918 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGATGACAACACACCACGACCGTCACTATAAAGCCGGTGGCGACCCGCGCACGCTGGCTGATTTTATGG
CCCTGCGTGCGGAAATGAACAAGCTCAGCCACCCGGCGCGGCCGGATATTAACTGGCCGTATGCCGAGCA
GCTTGCCCGCGGGCTGTTGGAGCATCACGGCGCGGACCTGCAGACTGTCGCCTGGTATACCCTGGCCCGC
GCCCGGCTGGGCGGGGTGGCAGGGATCAATGAGGGGCTGACGCTGATGGAGTCGCTGCTGGTTCGTCAGG
GGAAAAACCTGTGGCCACAGGCGCTCCCGGCCCGGACAGAGATCTTCCGCACCCTGAGCAAGCGGCTGCG
GCAGGTGATCCGTACCCTGAATCTTACCCCAGAGGATGTTGAGTCGCTTGAGCAGGCTGAACGTTCGCTG
CAAAGCTTCGACGCAGTACTCCAGCGCCTTGAGATCGCTCCTGAAAACCAGCTGAGCGACCTGCGGGCGC
TACTGCACAGCACGGCAACTCGCTTCGAGAGCCTCGACCCTGCGCCAGCGCTTCCCACCGCGCCGCCGGT
GGCGGTGTCTGACGCGGAACTTCCCGGCACTCTGGTCAGCGAAGAGGATGCGGCGAAGGTTGAGCCAGTG
CCAGACCTAAAACGTAGACCAAAGGCTGAGCCGCTGGCTCCGCCTTCACCTGCAAAGCGGCCCGCGCCGG
TGGCGGCGTCTACTCCCGCAGCCGCGCCGCGCTGGAAGCCGTTTATCGCCGGGATGGTTACCATGCTGGC
GGTAACGGGTATCGCCGTCGGCGGATGGCTGGCGCTGCGTCAGTCCGACTTGCCGCCCATTTCGGTCACC
CAAAATGCCGGACCGATACCGGGCCTGCCGGCGACAACGCCCCCGGGGCCGGTTGATCTGCCACAGACGC
AGCGCCAGCTTGGCGAGCTTGCCCGCCTGGCGCCGGACTGGGCGGTCAGCTACGGCGACCAGCTGGTCCA
CCAGGCCCTGATCCGCTGGCCGGATCAGGCGCAACCGCTGGCGCAGCAGTGGCGGCAGCAGCTGAGTGCT
GGCGCATTGCCCGCGGAAAACCTTACCGGCTGGTCGGAGGGCATGCAGCAACTGCAGCGGCTCGCCGACC
AGCTCAATGCCCTCGACGAGCAGAAGGGGAAGTACCTGACGGTGAGCGAACTGAAAACCGCAGTATTTGC
CATCACGCAGTCGTTTAACCGCGCTGTTCCGCTGGAGGAGCAGCTGCGCCAGCTGGCCGCGCTTCCCGTT
GATCAACCCTGGCCAGCCGCGCGGGGAAGCCTCGCGGAGCTGCATCTGCAACAGCTGATAGTGGAGTATG
CCCTGCTGAAGCGAAAACAGCCGGCGTCGCCGACCGCTGCGCTCCCCGCAACCGGTGAGCCCTCGGTGAG
TGAGGCGGTGAAATAA