SecReT6
Protein ID: 402781068
SecReT6 ID691
T6SS typei2
Gene symbol-
Locus tagA79E_2819
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2973735..2974277 [-]
Producthypothetical protein
NoteTssJ
UniProt IDK4H5C9
KEGG IDkpp:A79E_2819
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-35, Aligned region: 17..171
Protein Sequence: 180 a.a.     [Download]
>gi|402781068|ref|YP_006636614.1| hypothetical protein A79E_2819 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MLRISLTKTACLLPLLALCLSGCGLTQRVSEGTKSAFNAVFYKKINTLHLDFTAREALNTDARENHSLSE
PVVVRIYQLKDRQTFDRLVYQQLLEEGDILLAADLLASRDVVIGPGGDASLNMPLEAEATFVAVVGLFRH
PDTQRNTWKQVLAREELDPDKPRIFTAEHNQLRLRPEAAK
 
Nucleotide Sequence: 543 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c2974277-2973735 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
GTGTTACGTATAAGTTTGACTAAAACCGCCTGTCTGCTGCCCCTGCTTGCGCTTTGCCTGAGCGGATGCG
GACTCACCCAGCGCGTCTCGGAGGGAACAAAGTCTGCCTTCAACGCCGTTTTTTATAAGAAAATTAATAC
GCTGCATCTGGACTTTACCGCGCGCGAAGCGCTCAACACCGATGCCAGAGAGAATCACTCGCTCTCTGAA
CCGGTGGTGGTGCGCATCTATCAGCTTAAAGATCGCCAGACCTTTGACCGGCTGGTTTACCAGCAGCTGC
TGGAGGAGGGGGATATTCTGCTCGCCGCCGATCTCCTCGCCAGTCGCGATGTGGTGATCGGTCCCGGAGG
GGACGCCAGTCTGAATATGCCGCTGGAAGCGGAGGCGACGTTCGTGGCGGTTGTCGGCCTGTTCCGCCAT
CCGGACACACAAAGAAATACCTGGAAGCAGGTGCTGGCGCGTGAGGAATTGGATCCGGACAAGCCGCGCA
TTTTCACCGCCGAACACAACCAGCTACGGCTCAGGCCTGAAGCGGCGAAGTAA