SecReT6
Protein ID: 402781069
SecReT6 ID691
T6SS typei2
Gene symbol-
Locus tagA79E_2820
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2974255..2975340 [-]
Producthypothetical protein
NoteTssG
UniProt IDK4H4D3
KEGG IDkpp:A79E_2820
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.90E-73, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|402781069|ref|YP_006636615.1| hypothetical protein A79E_2820 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MGREAQPPHSRLTPRLEADLPRINFYRFCQLLEKRRPGQPLMGGTSHPADDPVRFYPHPGMGFPASELKA
VEYDEADDSRPPVIRTTFMGLYGVDSPLPTAYLDDIAQHREGHEALQGLLDIFSHRIMTQFYRIWRKYSW
PATFEPGGTDRLSQSLLGLAGLGIPGTTQHIASPASRFLALTGVLRQPGKTQQGIQALVTLLAPETTVRV
SPYSLRPVAISQPLGFYGDDDFFLDGNTPLGDEAMDASSQLLVALTTDNPAEAQGWKPDGPLFRDFLILL
RVYLGWRFRANITLTAPTRLLAVPPLGDEPFWLGMNGVLGVGEGESEGDIPQTFTTELGTYTGLQPATFL
QGNRRVTYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c2975340-2974255 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGGGAAGAGAAGCACAGCCGCCGCATTCCCGGCTGACCCCGCGACTGGAGGCCGACCTGCCGCGGATCA
ATTTTTACCGCTTCTGCCAGCTTCTGGAAAAACGGCGTCCCGGCCAACCGCTGATGGGGGGAACCAGCCA
TCCGGCTGACGATCCGGTGCGTTTTTACCCGCATCCGGGAATGGGATTTCCCGCCAGCGAACTGAAAGCC
GTGGAATACGATGAGGCCGATGACAGCAGGCCGCCGGTCATTCGCACCACCTTTATGGGGTTGTACGGTG
TCGATTCGCCGCTCCCGACGGCATATCTCGATGATATCGCCCAGCACAGGGAAGGGCATGAAGCGCTGCA
GGGCTTACTGGATATCTTCAGCCACCGGATCATGACGCAGTTTTACCGCATCTGGCGGAAATACTCCTGG
CCCGCCACCTTTGAGCCCGGCGGCACCGATCGTCTCTCGCAGTCGCTACTGGGCCTGGCGGGGCTGGGCA
TCCCCGGCACGACGCAGCATATCGCCTCGCCGGCGTCGCGCTTTCTGGCGCTAACCGGCGTGCTGCGTCA
GCCGGGCAAAACCCAGCAGGGGATCCAGGCGCTGGTCACCCTGCTGGCCCCGGAGACCACCGTCAGGGTG
AGCCCGTACAGCCTGCGTCCGGTGGCGATCAGCCAGCCGCTGGGGTTTTACGGCGATGACGACTTCTTCC
TGGACGGCAATACGCCGCTGGGTGACGAAGCGATGGATGCCAGCAGCCAGCTCCTCGTCGCCCTTACCAC
CGACAATCCCGCGGAGGCGCAGGGCTGGAAGCCTGACGGCCCGCTGTTTCGGGACTTTCTCATCCTGCTG
CGGGTATACCTCGGCTGGCGATTCCGGGCCAACATCACCCTGACCGCGCCGACCCGACTGCTGGCTGTCC
CGCCGCTGGGGGACGAGCCGTTCTGGCTCGGTATGAACGGCGTGCTGGGCGTGGGTGAGGGCGAGAGTGA
GGGCGATATTCCTCAGACCTTTACCACCGAGCTGGGTACCTATACGGGCCTGCAGCCTGCCACCTTTCTA
CAAGGAAACCGACGTGTTACGTATAAGTTTGACTAA