SecReT6
Protein ID: 402781070
SecReT6 ID691
T6SS typei2
Gene symbol-
Locus tagA79E_2821
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2975304..2977058 [-]
Productprotein ImpG/VasA
NoteTssF
UniProt IDK4HE42
KEGG IDkpp:A79E_2821
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.40E-180, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|402781070|ref|YP_006636616.1| protein ImpG/VasA [Klebsiella pneumoniae subsp. pneumoniae 1084]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAVMLNLDKAGARDPFVERLFEGFAFLMGRMREKLDDDLPE
LTEGVVSLLWPHYLRTIPSMSVVEFTPDWPEMKEPMTMAKGFEVLSRPIGEKGTRCRYTTTKAIALQPLS
LERVQLATDTDGRSVITLRFTCSQLTDWRRVDLSHIPLYCNADAPLACAMHEAFTLNVARMWLRMPDEVD
RRPLDGYFSALGFGEDDGLWPEDGRSFRGYQLLLEYFTFREKFMFIDLRGLETVVFPAGLAWFEIDVVLA
ERWEHDFRFSEKQLRLHCVPVINLFPLESDPLTINSLQTEYPLRPMRVQDGHTEIYTVDSVISSHQQVYA
PFSSFRHKGGMMRHDAADYYYHTRVRRGPSGLYNTWLIVGGEAFDNHTVPEDESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSASIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSSFLSLMDNAEVLRGTLALYEWTD
SEMNRRRLEAILDVKHRATERFAQGHLVRGVQIEVTLDSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHSRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c2977058-2975304 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGGACGATTTAACCCTGCGTTATTACGACGCTGAAATGCGCTACCTGCTGGAAGCGGGTGAAGAGTTTG
CCCGCGCTCATCCTGAGCAGGCGGTAATGCTCAATCTCGACAAAGCGGGCGCTCGCGACCCCTTTGTCGA
GCGTCTGTTTGAAGGTTTTGCCTTCCTGATGGGCCGCATGCGCGAGAAACTCGATGACGATCTGCCTGAG
CTGACCGAAGGCGTGGTCAGTCTGCTGTGGCCACATTATTTACGTACCATTCCCTCGATGTCGGTCGTGG
AGTTCACCCCCGACTGGCCGGAAATGAAAGAGCCGATGACGATGGCCAAAGGCTTTGAAGTGCTTTCCCG
GCCGATCGGTGAAAAGGGCACGCGCTGCCGGTACACCACCACCAAAGCGATCGCTCTGCAGCCGTTATCC
CTGGAGCGCGTCCAGCTGGCCACCGATACGGATGGCCGGTCGGTGATCACGCTGCGCTTTACCTGCAGCC
AGCTGACGGACTGGCGCCGGGTCGATCTCAGTCATATCCCGCTGTACTGCAACGCCGATGCGCCGCTGGC
CTGCGCCATGCACGAGGCCTTTACCCTCAATGTGGCCCGGATGTGGCTGCGCATGCCCGATGAGGTGGAC
AGAAGGCCGCTGGACGGGTATTTCAGCGCGCTTGGATTTGGCGAGGATGACGGCCTCTGGCCTGAAGATG
GCCGCAGTTTTCGCGGTTACCAGCTGCTGCTGGAGTATTTTACCTTCCGCGAAAAGTTCATGTTCATCGA
TCTGCGCGGGCTGGAGACGGTGGTTTTTCCGGCCGGACTGGCGTGGTTTGAAATCGACGTCGTGCTGGCG
GAACGCTGGGAACATGACTTCCGCTTCAGCGAAAAGCAGCTGCGCCTGCACTGCGTGCCAGTGATCAACC
TGTTTCCGCTGGAGTCCGATCCGCTGACCATCAATTCCCTGCAGACCGAATACCCGCTGCGCCCGATGCG
CGTGCAGGACGGCCACACCGAAATTTACACCGTCGATTCCGTGATCTCCTCACACCAGCAGGTTTACGCG
CCGTTCTCAAGTTTTCGCCACAAAGGCGGCATGATGCGTCATGACGCGGCGGACTATTACTATCATACCC
GGGTGCGCCGTGGCCCCTCCGGGCTGTACAACACCTGGCTTATCGTCGGCGGAGAAGCCTTTGATAATCA
TACCGTACCGGAAGATGAAAGCCTGTCGCTGACCCTCACCGGAACCAACGGCCAGCTGCCGCGTCGCGCG
CTGCAGAGCACCGTGCTCGATACGGTGATGAAAACCACTTCCGCCAGTATTGCAGTGCGTAACCTCTGCG
CGCCGACGCTGCCGTGCTATCCCCCCGCCCAGGACCGTTTTCACTGGCGGGTGCTGAGCCATCTGGGCAG
CAGTTTTCTTTCCCTGATGGATAACGCGGAGGTCCTGCGCGGCACCCTGGCGCTGTATGAATGGACCGAC
AGCGAGATGAATCGTCGGCGTCTGGAAGCCATCCTCGACGTGAAGCACCGCGCAACAGAGCGCTTTGCAC
AGGGCCATCTGGTGCGCGGCGTACAGATTGAAGTCACCCTCGACAGTCACGGCTTTGCCGGACGAGGCGA
TATATGCCTGTTTGGCGAGATGCTTAGCCGCTTCTTCGCGCTCTACACCGACATCTACTTGTTCAACCGC
CTGATTATCATTCTGCAACCAACCGGAGAACGACTGGAATGGGAAGAGAAGCACAGCCGCCGCATTCCCG
GCTGA