SecReT6
Protein ID: 402781072
SecReT6 ID691
T6SS typei2
Gene symbol-
Locus tagA79E_2823
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2978685..2980283 [-]
Producthypothetical protein
NoteTssA
UniProt IDK4H3Y4
KEGG IDkpp:A79E_2823
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.80E-21, Aligned region: 68..126
ImpA-rel_N [PF06812], Evalue: 5.80E-21, Aligned region: 302..314
Protein Sequence: 532 a.a.     [Download]
>gi|402781072|ref|YP_006636618.1| hypothetical protein A79E_2823 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MSILQNLVAASQLDESVLRQQARSRQAQWQSWLSPISDSQPTGSDPGYDDDFQRIREEVNKISGVDTVLI
CQLAGQLLATTKDIRIVTYYCWARLHQDGEAGLADGLELLAGLLQRYGMQLYPQRDRSRKAAIEWLAGTR
ILDSLSLFPEVVREDARRTVGALLLIDDCLTTEPETSRPDLQALWGALESRLIKGGGVDAVVPQNVGNRG
LAQTASRMAEYEAPVLSNITSGQDLLAQARTLTAYLRVQPDDWLAAHRLMKSLRHDTLTIIPAPDAEGKT
RIEPPRADQRAMLKRLYLQQSWSEILEQADSTFSRGANHLWLDLQWYIHQALVRSGQDVLADIIIADLKG
LLRRLTGLETLAFNDGTPFADEVTLNWINQSVLDDMSVWQDEPVSAASGADNDILALEPEALEKADTDGL
DAALHWIQTRPGTESTKEKWLLRLLMARVAEQKGKNDLALYLLRELDDAAGSITLTQWIPALLFEIKSRR
LRLLRMKATRSESEKLRLQPEMDQLLAGLIALDPASSAVLCG
 
Nucleotide Sequence: 1599 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c2980283-2978685 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGAGCATTTTACAAAATTTGGTTGCCGCCAGTCAGTTGGATGAAAGCGTACTGCGCCAGCAGGCCCGGT
CACGTCAGGCGCAGTGGCAGTCCTGGCTTTCGCCAATCAGTGATAGCCAGCCCACCGGGAGCGATCCGGG
CTATGACGATGATTTTCAGCGTATCCGCGAGGAGGTCAATAAGATCTCCGGTGTCGATACCGTACTGATT
TGCCAGTTGGCTGGACAGTTACTGGCAACAACAAAAGATATCCGGATTGTTACCTATTACTGCTGGGCCC
GTTTGCACCAGGACGGGGAAGCTGGCTTGGCCGATGGGCTGGAGCTGCTGGCAGGCTTGCTGCAACGATA
TGGTATGCAGCTTTATCCGCAGCGCGACCGTAGCCGCAAAGCAGCCATCGAGTGGCTGGCGGGTACTCGT
ATCTTAGACAGTCTTTCACTTTTTCCAGAAGTTGTGCGGGAGGACGCAAGGCGTACCGTCGGCGCGCTGC
TTCTCATTGATGATTGTCTGACGACAGAACCAGAAACATCACGGCCAGATCTGCAAGCACTCTGGGGTGC
ACTGGAGTCTCGTTTGATAAAGGGCGGGGGAGTCGATGCGGTGGTGCCGCAGAACGTCGGAAACCGGGGG
CTGGCTCAAACCGCTTCACGCATGGCTGAATACGAAGCGCCGGTTCTCAGTAACATCACCTCCGGTCAGG
ATCTGCTGGCCCAGGCGCGAACCCTGACAGCATATCTGCGTGTTCAACCCGATGACTGGCTTGCCGCACA
TCGGCTAATGAAAAGCCTTCGTCATGACACCTTGACAATCATCCCTGCGCCTGATGCTGAAGGAAAAACA
CGTATCGAGCCTCCCAGAGCAGATCAGCGTGCCATGCTCAAGCGGCTGTACCTGCAACAGAGCTGGTCGG
AGATACTGGAACAGGCGGACAGTACCTTCTCACGTGGCGCTAACCACCTCTGGCTTGACCTGCAATGGTA
TATCCATCAGGCGCTGGTGAGGTCGGGTCAGGATGTGCTGGCCGATATTATAATTGCCGATCTGAAAGGA
TTGCTGCGCCGTCTCACCGGGCTTGAAACATTAGCTTTTAACGACGGCACACCCTTTGCCGATGAGGTCA
CGCTGAACTGGATAAATCAGAGTGTCCTCGACGATATGTCCGTCTGGCAGGATGAGCCAGTATCGGCTGC
CAGCGGCGCTGATAACGACATTCTGGCCCTTGAACCTGAAGCGCTCGAGAAGGCTGACACTGACGGTCTC
GATGCTGCACTCCACTGGATTCAGACGCGCCCGGGCACTGAATCCACTAAAGAAAAATGGCTGTTGCGCC
TGCTTATGGCCCGCGTGGCCGAACAAAAGGGGAAGAATGACCTCGCGCTCTATCTTCTGCGAGAACTCGA
CGATGCGGCGGGATCAATCACCCTCACGCAGTGGATCCCAGCCCTGTTGTTCGAGATTAAATCGCGACGG
CTCAGGCTACTGCGCATGAAAGCCACGCGCAGCGAGAGTGAAAAGTTACGATTGCAACCGGAGATGGATC
AATTGCTGGCAGGTCTGATTGCGCTCGATCCAGCCAGTAGCGCGGTGCTTTGCGGCTAA