SecReT6
Protein ID: 402781081
SecReT6 ID691
T6SS typei2
Gene symbol-
Locus tagA79E_2832
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2991421..2994111 [-]
ProductVgrG protein
NoteTssI
UniProt IDK4H8V0
KEGG IDkpp:A79E_2832
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-66, Aligned region: 31..352
DUF2345 [PF10106], Evalue: 9.00E-43, Aligned region: 550..563
DUF2345 [PF10106], Evalue: 9.00E-43, Aligned region: 608..750
T6SS_Vgr [PF13296], Evalue: 2.00E-35, Aligned region: 486..589
T6SS_Vgr [PF13296], Evalue: 2.00E-35, Aligned region: 585..614
T6SS_Vgr [PF13296], Evalue: 2.00E-35, Aligned region: 626..651
Phage_base_V [PF04717], Evalue: 1.60E-16, Aligned region: 336..354
Phage_base_V [PF04717], Evalue: 1.60E-16, Aligned region: 386..479
Protein Sequence: 896 a.a.     [Download]
>gi|402781081|ref|YP_006636627.1| VgrG protein [Klebsiella pneumoniae subsp. pneumoniae 1084]
MKSLLFSHNHHLLSVKGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAASLTLQAPVAQ
GFGINVQQPVRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNAIYQDQSVPQIVEKILRERHG
LRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLHIDVAEFCDSQQGYEKGLTL
PSVPPSGQQSAGVDAVWEMACRHRVVEQQVSTRDYNYREATADMNAQVDVTRGETTTFGEAYHWGDNYLT
AGNVHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCPTLCPGQVLKVTGGEEVAGEFADGVLVTAMHS
HARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYRVNMLFDRARW
ETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVTIRNDKRNVLR
TPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAEKQPRGEGFELRTDSWGAIRAQKGIFISADGQ
VQAQGQVLDMEPAVSNLAEAREQMMSISGDAQKATANPADLQAQITLLEQQLTDLKKSVLLVSAPEGIAL
TSGEHLQVSAGHNLIATAGKNADVSVVKNLFIGVGSALSVFVRKLGIRLIANQGPVQMQAQNDLMALLAR
KEISIVSTEDEIKIIAKKKLTLNGGGSYIRLDANAIESATAGEYRTKAGYYGRQESASEKVKMPVFPVME
PGEHSLRFAFPGADSVSQSMNWLINQPYSISDSAGKILSTGTVDTSGRFPKIVLPESDTLNLIIGRETWS
KEELSVSSTEDDSMEDFEDEAPDADLHLSEMGFEDDRTSALTESMISTLLSLTKDS
 
Nucleotide Sequence: 2691 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c2994111-2991421 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
GTGAAATCGTTGTTGTTCAGCCATAACCACCACCTGCTTTCGGTGAAGGGATGTGAAGCCGGGCTTGATG
TGCTGGCCTTCGAGGGCGATGAAGCCCTGAGCCAGCCGTTCCGCTACCGTATTGAATTCACCAGCGCAGA
CCATGCCATCAGCAAAGAGATGATGCTGATGAAGGCAGCCTCCCTGACGCTGCAGGCGCCGGTGGCTCAG
GGCTTCGGCATCAATGTTCAGCAACCCGTGCGGGTGATCCAGGGCGTGGTGACGGGGTTTGAACGGCTCA
GTACCTCCAGGGATGAAACGCACTACGCGCTGACGCTTCAGCCGCGCCTGGCGCTGCTTAACCGCTCGCA
CCAGAACGCCATTTACCAGGACCAGTCCGTTCCGCAGATTGTGGAAAAAATCCTCCGCGAGCGCCACGGC
CTGCGCGGTCAGGATTTTCTGTTCTCGCTGACAAAAACGTATCCGCGACGCGAGCAGGTGATGCAGTACG
GCGAGGATGACCTGCGCTTTATCACCCGGCTGCTGGGTGAGGTGGGGATCTGGTTTCGGTTTACCGCCGA
CACGCGGCTGCACATCGACGTCGCTGAGTTCTGCGACAGTCAGCAGGGCTATGAGAAGGGGCTGACGTTG
CCTTCGGTCCCGCCGTCAGGGCAGCAGTCGGCCGGGGTGGACGCGGTGTGGGAGATGGCATGTCGCCACC
GCGTCGTGGAGCAGCAGGTCAGTACCCGCGACTACAACTACCGCGAGGCGACGGCGGACATGAACGCGCA
GGTGGATGTCACCCGCGGGGAGACCACTACCTTTGGTGAGGCTTACCACTGGGGAGATAACTACCTGACC
GCGGGGAATGTCCATGACCGCCATCCGGCGCCGGAGTCCGGGGCGTTTTACGCCCGGCTTCGGCATGAGC
GTTATCTTAACGGCCAGACCCGGATGCAGGCCACCACCAGCTGCCCGACGCTCTGCCCGGGACAGGTGCT
GAAGGTCACCGGCGGAGAGGAGGTGGCCGGGGAGTTTGCTGATGGCGTGCTCGTCACGGCGATGCACAGC
CACGCCCGGCGCGATGCCGACTTTGCGGTGGAGTTTGCCGGCATACCGGACAGCCCGGACGTCGGCTACC
GGCCTGAGCCCGGCGCGCGTCCGGTGATGGCCGGGACGCTGCCGGCCCGCGTGACCAGCACCCGGGAAAA
CGACACCTACGGGCATATCGACAAACACGGACGCTACCGGGTGAATATGCTGTTTGACCGGGCGCGCTGG
GAAACCGGTTTCGAGAGCCTGTGGGTCCGCCAGTCGCGGCCGTATGCCGGAGACACCTACGGCCTGCACC
TGCCGCTGCTGGCCGGGACGGAGGTGGCGATTGGCTTTGAGGATGGTAACCCTGACCGGCCGTATATCGC
GGGCGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCCGCAATGACAAACGTAACGTCCTGCGC
ACCCCGGCCAACAACAAAATCCGCCTCGACGATGAGCGCGGAAAAGAGCATATCAAGGTCTCGACGGAGT
ACGGCGGTAAGAGCCAGCTGAACCTCGGCCATCTCGTGGATGCTGAAAAGCAGCCGCGCGGCGAAGGCTT
TGAGCTGAGAACCGACAGCTGGGGCGCTATCCGGGCACAGAAAGGGATATTTATCAGCGCGGACGGACAG
GTGCAGGCTCAGGGGCAGGTGCTGGATATGGAGCCGGCGGTCAGCAATCTGGCCGAAGCCCGGGAGCAGA
TGATGTCCATCTCCGGTGACGCGCAGAAGGCGACCGCGAACCCGGCCGATCTCCAGGCGCAAATTACCCT
GCTGGAGCAGCAGCTGACAGACCTCAAAAAATCGGTACTGCTGGTCAGCGCGCCGGAGGGGATAGCGCTG
ACCAGCGGGGAGCACCTGCAGGTCTCAGCCGGGCATAACCTGATTGCCACAGCCGGAAAGAATGCAGACG
TCAGCGTGGTGAAAAATCTGTTCATCGGGGTGGGCAGTGCGCTGAGCGTGTTTGTGCGAAAGCTTGGGAT
CAGGCTGATAGCGAATCAGGGACCGGTACAGATGCAGGCGCAGAATGACCTGATGGCGCTGCTTGCCCGG
AAGGAAATCAGCATTGTCAGCACGGAGGATGAAATCAAAATCATCGCGAAGAAGAAGCTGACCCTGAATG
GTGGGGGGAGTTATATCAGACTTGATGCAAATGCGATTGAATCTGCTACTGCAGGCGAATATCGCACGAA
AGCAGGATATTACGGGCGTCAGGAAAGCGCTTCTGAAAAAGTCAAAATGCCTGTATTTCCTGTAATGGAG
CCTGGAGAGCACAGTTTACGTTTTGCTTTTCCAGGTGCGGATAGTGTCAGCCAGAGTATGAACTGGCTGA
TAAATCAGCCGTACAGTATTTCTGATAGCGCTGGAAAAATTCTGTCTACCGGAACAGTAGACACTTCAGG
TCGTTTTCCCAAAATAGTACTTCCTGAAAGCGATACATTAAATTTAATCATTGGCCGAGAAACTTGGAGT
AAAGAGGAGCTTTCTGTCTCATCAACTGAAGACGACAGTATGGAGGATTTTGAGGATGAAGCACCTGATG
CCGATCTTCATTTAAGTGAAATGGGTTTTGAAGATGATAGAACATCAGCATTGACTGAATCAATGATTTC
AACTTTATTAAGTTTAACAAAGGATAGTTGA