SecReT6
Protein ID: 402781086
SecReT6 ID691
T6SS typei2
Gene symbol-
Locus tagA79E_2837
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2999230..2999919 [-]
Producthypothetical protein
NoteTssL
UniProt IDK4H8V4
KEGG IDkpp:A79E_2837
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-38, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|402781086|ref|YP_006636632.1| hypothetical protein A79E_2837 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MNEPKRGNAASIDIDALLQNTWLQVISLRHGPQFRDEEGYTLWQRCIADVERVQHELKASGLDDASCQHI
LTAQCALLDEAVKGRGVEDEACLQWYDIPLQGHFLGTMDAGDTLCERMRDVLREPAPNLAVVTCFQRVML
LGFIGSFRSLHDPERLKLVNALGERVPPFQCPATAPVLVESRAGLGISGWLAPWPVRIGLSVVVVLALWW
GLNHWLDHLLLTLLPGEVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c2999919-2999230 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
GTGAATGAGCCTAAACGCGGCAACGCCGCGTCCATTGATATTGATGCGCTGCTGCAGAACACCTGGCTGC
AGGTTATCAGCCTGCGCCACGGCCCGCAGTTCCGCGATGAGGAAGGGTACACGCTATGGCAGCGCTGTAT
TGCTGATGTCGAGCGCGTGCAACATGAGCTGAAGGCGAGCGGGCTTGATGACGCCAGCTGTCAGCATATT
CTCACCGCCCAGTGCGCGCTGCTCGATGAAGCAGTGAAAGGTCGCGGCGTGGAGGATGAGGCCTGCCTGC
AGTGGTATGACATTCCGCTGCAGGGGCACTTCCTCGGCACCATGGACGCCGGCGACACCCTGTGCGAGCG
GATGCGTGATGTGTTGCGTGAACCGGCGCCCAACCTGGCCGTGGTCACCTGTTTTCAGCGGGTGATGCTG
CTGGGTTTTATTGGCAGCTTTCGCTCCCTCCACGACCCCGAGCGCCTGAAGCTGGTCAACGCGCTCGGTG
AGCGTGTTCCTCCTTTTCAGTGCCCGGCTACCGCTCCCGTACTGGTAGAGAGTCGCGCCGGTCTGGGGAT
AAGCGGCTGGCTGGCCCCATGGCCGGTACGTATTGGCCTGAGCGTGGTGGTGGTACTCGCCCTGTGGTGG
GGGCTCAACCACTGGCTCGATCACCTGCTGCTGACCTTGTTACCGGGGGAGGTGAAATGA