SecReT6
Protein ID: 402781087
SecReT6 ID691
T6SS typei2
Gene symbol-
Locus tagA79E_2838
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]2999916..3001259 [-]
Producthypothetical protein
NoteTssK
UniProt IDK4H3Z9
KEGG IDkpp:A79E_2838
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.70E-136, Aligned region: 19..444
Protein Sequence: 447 a.a.     [Download]
>gi|402781087|ref|YP_006636633.1| hypothetical protein A79E_2838 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MMKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVVEATFEPEMLKLGRLQAHRLQVRFQ
DGTMIDTDNADALPSALSLDGASGEAVIVLALPLMQANGGNCLKPEEVAERPVRFRQRWRDVRNQFGDDT
RQIAVIQPELILRFAHQDNSDYLTCPLVRLQRDSQGAWLIDETFLPPLLQIQGSRWLATQLEQLLVQLRA
RLTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGYFLRYRQSPPERLYPELARLAGSLLTFSL
THQANAVPIYQHDQLNAVFPPLFDLLSDLLEASLPSRVVAIALEHDVRLHFWQARLHDARLREGADYYLS
VRSSVPVAQLQEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEM
LQSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c3001259-2999916 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGATGAAAACGGAACGTCCGTTGTGGGGCCGGGGCATTATGGTGTCGCCTCAGCATTTTCAACAGCAGG
CTGCGTATGCAGCCTGGACTGCGGAAGTGATTGCCCGGATGGGTCTTAACCACCCCTGGGGAGTGGTTGA
GGCGACCTTCGAACCAGAGATGCTCAAACTGGGCCGCCTGCAGGCTCACAGGCTGCAGGTCCGGTTCCAG
GATGGCACGATGATTGATACGGACAATGCCGATGCGCTGCCGTCCGCGCTGTCGCTGGACGGCGCGTCCG
GCGAGGCGGTGATCGTGCTGGCGCTGCCCCTGATGCAGGCGAATGGCGGCAACTGTCTGAAGCCGGAGGA
GGTGGCCGAAAGGCCGGTGCGCTTCCGCCAGCGCTGGCGCGATGTCCGCAACCAGTTTGGGGATGATACC
CGGCAGATTGCCGTCATACAGCCGGAGCTGATCCTCCGCTTCGCCCACCAGGACAACAGCGATTACCTGA
CCTGTCCGCTTGTTCGCCTGCAGCGGGACTCGCAGGGGGCCTGGCTTATCGACGAGACGTTTCTCCCGCC
GCTGCTGCAGATCCAGGGCAGCCGCTGGCTGGCGACGCAGCTTGAACAGCTGCTCGTCCAGCTCCGGGCT
CGTCTGACGCGCCTGATGGCCATGCGTCGCGAAAGCAATGAACGGATGGCTGATTTTGCCGTGGCTGATG
TCTCTCTGTTCTGGTTGCTGAATGCGCTGAACAGCGCCGAGCCGGTGCTGGGGTACTTTCTGCGTTACCG
GCAAAGCCCGCCGGAACGCCTCTACCCGGAGCTGGCGCGCCTGGCTGGTAGCCTGCTGACCTTTTCGCTC
ACCCATCAGGCGAATGCCGTCCCGATCTATCAGCATGACCAGCTGAACGCGGTTTTTCCGCCGCTGTTTG
ATTTACTGAGCGACCTGCTGGAGGCGAGCCTGCCATCGCGGGTGGTGGCGATTGCGCTGGAGCATGATGT
CCGGCTGCACTTCTGGCAGGCGCGTCTGCACGATGCCCGGCTGCGGGAAGGGGCTGATTACTACCTGTCG
GTTCGTTCGTCGGTACCGGTCGCCCAACTGCAGGAGCAGTTTCCGCGCCAGTGCAAAGTGGGCAGTCCGG
ATCATGTCAAAGCCATCGTCAACTCCTCGCGGACAGGGGTGCCCCTCACGCCATTGCGTCATGTGCCGGC
GGCGATCCCGCTGCGTCTGGAAAATCAGTATTTCAGCCTCGATGTGTCCCACCCTCTGGCAACGGAAATG
CTGCAGAGCGGCACCTGTATGTTTTACGTCCCGGGGATGCTCGGTGAGCCTGAACTTGAACTTTTTGCGG
TACTACGAACGTGA