SecReT6
Protein ID: 402781088
SecReT6 ID691
T6SS typei2
Gene symbol-
Locus tagA79E_2839
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]3001269..3002813 [-]
Producthypothetical protein
NoteTssC
UniProt IDK4H5G0
KEGG IDkpp:A79E_2839
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-171, Aligned region: 88..510
Protein Sequence: 514 a.a.     [Download]
>gi|402781088|ref|YP_006636634.1| hypothetical protein A79E_2839 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MSVTTENAPVQGQTTLQENSAGEGVYASLFEKINLTPASRLGDINDFLDDAALSEAPAAERLTAAMQVFM
ERIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWRGLKQLVDNTDYRQNVKTEIL
DVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISRVSAAAHM
PFIGAVGPAFFLKETMEEVAAIKDIGNYFDRAEYIRWKAFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHEKYLWTSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c3002813-3001269 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
ATGTCTGTTACCACAGAAAACGCCCCTGTTCAGGGGCAAACCACGCTGCAGGAAAACAGCGCGGGCGAGG
GCGTTTACGCCTCGCTGTTTGAAAAAATTAATCTCACCCCGGCGTCTCGCCTCGGGGATATCAACGACTT
TCTGGACGATGCCGCGCTCTCCGAGGCGCCGGCGGCGGAACGTCTCACCGCGGCGATGCAGGTGTTTATG
GAACGCATCCGTCAGTCCGGCCAGCGGGTGGAAAAGCTCGACAAAACGCTGATCGACCACCATATCGCCG
AGCTGGATTTCCAGATAAGCCGTCAGCTGGACGCGGTGATGCACCATCAGGAGTTTCAGCAGGTCGAATC
CCTGTGGCGCGGCCTCAAACAGCTGGTGGACAACACCGACTATCGGCAGAACGTCAAAACGGAGATCCTC
GACGTCGCCAAAGACGATCTGCGCCAGGACTTTGAGGACGCGCCGGAGCTTATCCAGAGCGGCCTCTACT
GGCACACCTATACCGCGGAGTATGACACTCCCGGCGGCGAGCCGATCGGCTCGGTGATCTCGGCCTATGA
GTTCGACGCCAGCCCGCAGGATGTGGCGCTGCTGCGCAATATCTCCCGCGTCTCTGCGGCCGCCCATATG
CCGTTTATCGGCGCCGTCGGCCCGGCCTTCTTCCTGAAAGAGACCATGGAAGAGGTGGCTGCCATTAAGG
ATATCGGCAACTACTTCGATCGTGCGGAATATATCCGCTGGAAGGCGTTTCGCGAAACTGACGATGCCCG
CTACATCGGTCTGGTGATGCCGCGCGTGCTGGGTCGTCTGCCGTACGGTCCGGACACCGTGCCGGTGCGC
AGCTTCAACTATGTCGAGCAGGTGAAGGGCCCGGACCACGAAAAGTATCTCTGGACCAGCGCGGCGTTCT
CCTTCGCTTCCAATATGGTGAAGAGCTTTGTCAATAACGGCTGGTGCGTGCAAATTCGCGGTCCGCAGGC
CGGCGGCGCGGTGAAAGATCTGCCCATCCATCTGTATGATCTGGGCACCGGCAACCAGGTGAAAATTCCT
TCCGAGGTGATGATCCCGGAAACGCGGGAGTTTGAGTTCGCCAGCCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAATCGCGATTACGCCTGCTTCTTCTCGGCCAACTCCGCGCAGAAACCGGCGCTGTACGATACCGC
CGACGCCACCGCCAACAGCCGTATCAACGCGCGTCTGCCTTATATCTTCCTGCTGTCGCGCATCGCGCAC
TACCTGAAGATGATCCAGCGCGAGAATATCGGCACCACCAAGGACCGGCGTCTGCTGGAGCTGGAGCTGA
ACACCTGGGTGCGGAGCCTGGTGACCGAAATGACCGACCCCGGCGACGAGCTGCAGGCCTCCCATCCGCT
GCGCGATGCCAGCGTGGTGGTGGAAGATATCGAGGATAACCCGGGCTTCTTCCGCGTGAAGCTGTACGCG
GTGCCGCACTTCCAGGTCGAGGGGATGGACGTCAATCTGTCGCTGGTTAGCCAGATGCCAAAGGCGAAGG
CGTAG