SecReT6
Protein ID: 402781089
SecReT6 ID691
T6SS typei2
Gene symbol-
Locus tagA79E_2840
StrainKlebsiella pneumoniae subsp. pneumoniae 1084
Repliconchromosome [GenBank: NC_018522] [Browse all T6SS(s) in this replicon]
Location [Strand]3002856..3003434 [-]
Producthypothetical protein
NoteTssB
UniProt IDK4H4F5
KEGG IDkpp:A79E_2840
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.10E-52, Aligned region: 35..187
Protein Sequence: 192 a.a.     [Download]
>gi|402781089|ref|YP_006636635.1| hypothetical protein A79E_2840 [Klebsiella pneumoniae subsp. pneumoniae 1084]
MIVNPFLLYHRHVSHQYIFNNYFLRKGTAMADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDF
SHGKENRPLSEREKINVNKNNFNSVLSEFSPEVNLSVPNTLAGNGEEENVRLRFTDIKDFEPEQVARQIP
QLRAMLAMRNLLRDLKSNLLDNATFRKELEAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 579 bp     [Download]
>gi|402778297|ref|NC_018522.1|:c3003434-3002856 Klebsiella pneumoniae subsp. pneumoniae 1084 chromosome, complete genome
TTGATCGTTAATCCATTTTTGCTTTATCATCGTCACGTTTCACATCAATATATCTTCAATAATTATTTCT
TAAGGAAAGGAACTGCTATGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATT
ATCTCTTCATACCGGCGGCGCGCAAAAGAAGGTCGAACTGCCGCTCAAACTGCTTACCATTGGCGATTTT
AGTCATGGTAAGGAAAACCGGCCTTTATCGGAAAGAGAAAAAATCAACGTCAATAAAAATAATTTTAACA
GCGTACTTTCGGAATTTAGCCCGGAAGTTAACCTCTCGGTGCCGAATACGCTGGCCGGCAATGGCGAAGA
GGAGAACGTCAGACTGCGTTTTACCGACATCAAAGATTTTGAACCGGAGCAGGTTGCCCGGCAAATTCCG
CAACTCCGCGCCATGCTGGCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTCGATAACGCCA
CTTTCAGAAAAGAGCTTGAGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAG
TGCGCTTGCCCCGAAATAA