SecReT6
Protein ID: 402783618
SecReT6 ID641
T6SS typei1
Gene symbol-
Locus tagHCN_1422
StrainHelicobacter cinaedi PAGU611
Repliconchromosome [GenBank: NC_017761] [Browse all T6SS(s) in this replicon]
Location [Strand]1416768..1417670 [-]
Producttype VI secretion protein VC_A0111 family
NoteTssG
UniProt IDI2FJ74
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-44, Aligned region: 21..285
Protein Sequence: 300 a.a.     [Download]
>gi|402783618|ref|YP_006638949.1| type VI secretion protein VC_A0111 family [Helicobacter cinaedi PAGU611]
MNNTTYFTFHKLLYKLLKKYDKRDIFLRTNKSLKHPHKEIEYIEENKEFLIEIMVNFMGLQGNTSQLPSY
MLDKLSRNEDGGSGWTLFFDFFNHYILWLFFESANLKNYSRSFKKDFSDSISKILFSILGINDREIAKNY
LPFAPLLLSASRPKYYIEKVLQSNFNLHNKLYIIENLPHQIFIAPSQKNKLGIKNDVLGKNFILGSKFLS
YQSKIGIYIKDIEYHRAIEYLPNQNKHEELKESILFLTNHQFCIDLYLRINHNEKMNFILGDESVAKLSW
GLALGNFKKKYHLMCIKMYE
 
Nucleotide Sequence: 903 bp     [Download]
>gi|386760820|ref|NC_017761.1|:c1417670-1416768 Helicobacter cinaedi PAGU611, complete genome
ATGAACAATACGACTTATTTTACTTTCCATAAGCTTCTTTATAAGCTTCTTAAAAAATACGACAAAAGGG
ACATTTTTTTAAGAACCAATAAAAGCCTCAAACACCCTCATAAAGAGATTGAATACATTGAAGAAAATAA
AGAGTTTTTGATTGAAATAATGGTAAATTTTATGGGATTGCAAGGCAATACATCACAACTACCCTCTTAT
ATGCTTGATAAGCTCTCAAGGAATGAAGATGGAGGCTCTGGATGGACATTATTCTTTGATTTTTTTAATC
ATTATATTCTTTGGCTCTTTTTTGAAAGCGCGAATTTGAAAAATTATTCTAGAAGTTTCAAAAAAGATTT
TAGTGATTCTATTTCAAAGATTTTATTTTCTATATTGGGCATTAATGATAGAGAAATTGCTAAAAATTAT
TTGCCTTTTGCACCTTTGCTTTTAAGTGCCTCTCGTCCTAAATATTATATAGAAAAAGTATTGCAAAGTA
ATTTTAATTTGCATAATAAATTATATATCATTGAAAATCTCCCACATCAGATTTTCATCGCTCCTTCTCA
AAAAAATAAATTAGGTATTAAAAATGATGTTTTAGGTAAAAATTTTATTTTAGGGAGTAAATTCCTCTCT
TATCAGAGCAAGATAGGTATTTATATCAAAGACATTGAATACCATAGAGCCATAGAATATTTACCCAATC
AAAATAAACACGAAGAACTCAAAGAGAGCATACTATTTCTTACCAATCATCAATTTTGTATTGACTTGTA
TTTGCGTATTAACCACAATGAAAAAATGAATTTTATTCTAGGTGATGAAAGTGTAGCAAAACTTAGTTGG
GGATTAGCATTGGGGAATTTTAAGAAAAAATATCATTTAATGTGTATTAAAATGTATGAATAA