SecReT6
Protein ID: 402783619
SecReT6 ID641
T6SS typei1
Gene symbol-
Locus tagHCN_1424
StrainHelicobacter cinaedi PAGU611
Repliconchromosome [GenBank: NC_017761] [Browse all T6SS(s) in this replicon]
Location [Strand]1419391..1419783 [-]
Producthypothetical protein
NoteTssE
UniProt IDI2FJ75
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-09, Aligned region: 24..107
Protein Sequence: 130 a.a.     [Download]
>gi|402783619|ref|YP_006638950.1| hypothetical protein HCN_1424 [Helicobacter cinaedi PAGU611]
MSLLGKIIHQLDDQCQNIPFYQNEFEDIKTNIQALLNTKLDDCIIANDLGLSNVVEFNLNASDLCFKMAK
EIHFLISKYERRIRILSIRYDNSLTPWQISFFLQCNFFQDHFKEFSLEIIFKNDRYCEVF
 
Nucleotide Sequence: 393 bp     [Download]
>gi|386760820|ref|NC_017761.1|:c1419783-1419391 Helicobacter cinaedi PAGU611, complete genome
ATGTCATTGCTTGGCAAGATCATTCATCAGTTAGACGATCAGTGTCAAAATATTCCTTTTTATCAAAACG
AATTTGAGGATATTAAGACCAACATTCAAGCTTTACTTAATACCAAGTTAGATGATTGTATTATAGCTAA
TGATTTGGGTTTGTCAAATGTTGTAGAATTTAATTTAAACGCAAGTGATTTATGCTTCAAAATGGCTAAA
GAGATTCATTTCCTTATAAGCAAATATGAGCGGAGAATTAGAATCTTATCTATTCGTTATGACAATTCTT
TGACGCCTTGGCAAATTTCATTCTTTTTGCAATGCAATTTTTTTCAAGACCATTTTAAAGAATTTAGTTT
AGAAATTATTTTTAAAAATGATAGATATTGTGAGGTCTTTTAG