SecReT6
Protein ID: 402783621
SecReT6 ID641
T6SS typei1
Gene symbol-
Locus tagHCN_1430
StrainHelicobacter cinaedi PAGU611
Repliconchromosome [GenBank: NC_017761] [Browse all T6SS(s) in this replicon]
Location [Strand]1425086..1425853 [+]
Producttype IV/VI secretion system protein
NoteTssL
UniProt IDI2FJ77
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.50E-40, Aligned region: 26..233
DUF624 [PF04854], Evalue: 0.0083, Aligned region: 177..232
Protein Sequence: 255 a.a.     [Download]
>gi|402783621|ref|YP_006638952.1| type IV/VI secretion system protein [Helicobacter cinaedi PAGU611]
MQKQSSAETQEFSLLLSSGLSGLGNNKVVDYCLELLLLSFRLSKVTLLDTSTIESLREKIVNDILTWSSK
LSALREYDEKDIIRLRYCLCVFIDEMLMKNELFINSSWANNTLTVRLFDETLGGDNFYDITHSWLNNPAK
NKDFLEFIYACLVLGYKGKYSNNKDIEERILLFCNNIASSLTPLYDVSEELAFTKAYDGIMKESFWQNFQ
RMYLKKILIALPLCIIVGVFIYAVFDLEVNNRRIHDSVNEIIKNY
 
Nucleotide Sequence: 768 bp     [Download]
>gi|386760820|ref|NC_017761.1|:1425086-1425853 Helicobacter cinaedi PAGU611, complete genome
ATGCAAAAACAATCAAGTGCAGAGACACAAGAATTTAGTTTGCTTTTAAGTTCCGGTTTAAGCGGTCTTG
GAAATAATAAAGTTGTTGATTATTGTTTAGAACTCCTCTTGCTCTCTTTTAGATTATCTAAAGTAACCTT
ACTTGATACAAGCACCATAGAATCCCTTAGAGAAAAAATTGTCAATGATATTTTGACTTGGAGTTCCAAA
CTTAGTGCTTTAAGAGAATATGATGAAAAAGACATTATTAGGCTTAGATATTGCCTTTGTGTTTTCATTG
ATGAGATGTTAATGAAAAATGAGCTTTTTATTAATAGCTCTTGGGCAAATAATACCCTAACAGTGCGTTT
ATTTGACGAAACTTTAGGGGGAGATAATTTTTATGATATAACACATTCTTGGCTTAACAATCCTGCCAAA
AACAAAGATTTTTTAGAATTTATTTATGCCTGTCTTGTATTGGGTTACAAAGGCAAATATTCAAACAACA
AAGATATAGAAGAAAGAATTTTGCTTTTTTGTAATAATATTGCTTCTTCTCTCACACCATTATATGATGT
TAGTGAAGAACTAGCCTTTACAAAAGCTTATGATGGAATCATGAAGGAGAGTTTTTGGCAAAATTTTCAA
AGAATGTATCTTAAAAAAATTTTAATTGCTTTGCCTTTATGTATCATTGTAGGAGTTTTTATCTATGCTG
TATTTGACCTTGAAGTTAATAACAGACGAATACACGATAGCGTGAATGAAATTATCAAAAATTATTAA