SecReT6
Protein ID: 40287636
SecReT6 ID791
T6SS typei4b
Gene symbolevpA
Locus tagEvpA
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]4431..4946 [+]
ProductEvpA
NoteTssB
UniProt IDQ6EE21, Q6EE21
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.10E-59, Aligned region: 10..163
Protein Sequence: 171 a.a.     [Download]
>gi|40287636|ref|AAR83927.1| EvpA [Edwardsiella tarda]
MASESKQHTLDRVRSPRVQITYDVEIGDAQEMKELPFVMGVLGDYSGQPATPLPKLKERKFVSIDRDNFN
DVIKGVHPHLSFRTENTLSGDDSQLSVDLHFQSMADFTPERVAAQVEPLRKLMDIRSRLSDLKNKMYSNE
RLGEVLQGIIEDTEKLQSLGKETGFGEEKQP
 
Nucleotide Sequence: 516 bp     [Download]
>gi|158512110|gb|AY424360|evpA|:4431-4946
ATGGCAAGTGAAAGCAAGCAGCATACGTTGGATCGAGTCCGCTCGCCAAGAGTGCAGATTACCTATGATG
TTGAAATTGGCGATGCGCAGGAAATGAAGGAGCTGCCATTTGTTATGGGAGTGCTCGGTGACTATTCAGG
GCAGCCGGCGACTCCGCTTCCCAAGCTGAAAGAGCGCAAATTCGTTTCGATTGATCGCGACAACTTCAAC
GATGTTATCAAAGGGGTGCATCCCCATCTGTCATTCCGCACCGAGAATACCCTGAGCGGAGATGACAGCC
AGCTGTCGGTGGATCTGCATTTTCAGAGCATGGCGGATTTCACCCCAGAGCGGGTCGCGGCGCAGGTTGA
GCCGCTGCGCAAGCTGATGGATATCCGCAGCCGCCTCTCTGACCTGAAAAACAAGATGTACAGCAATGAA
CGCCTGGGTGAGGTATTGCAGGGCATCATTGAGGATACCGAAAAGCTGCAGAGTCTGGGTAAAGAGACCG
GCTTTGGCGAGGAGAAGCAGCCATGA