SecReT6
Protein ID: 40287637
SecReT6 ID791
T6SS typei4b
Gene symbolevpB
Locus tagEvpB
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]4943..6430 [+]
ProductEvpB
NoteTssC
UniProt IDQ6EE20, Q6EE20
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-192, Aligned region: 67..490
Protein Sequence: 495 a.a.     [Download]
>gi|40287637|ref|AAR83928.1| EvpB [Edwardsiella tarda]
MSEQNLPESSAAESAALEGGLLDSIIAETRMARSDLEKARARDLLGEWVSEVLSGTVTVSGDVLASIEAR
IAQIDALLSAQLSAIMHEPAFQKLEGSWRGLHYLVHQSETGTGLKIRMLNVSRADLIRDFKSAAEFDQSA
LFKKVYEEEYGTFGGAPFAAMIGDYEFSNHPEDLFLLEEISHVAAAAHAPFLSAASAGMFGLDSLTELSI
PRDLAKGFDTVEYAKWKSLRQSEDARYIALALPHVLGRLPYGATTVPVESFNFEENVSGKEHGKYLWLNA
AYALGTRLTQAYAKYGWCAAIRGAEGGGLVEGLPAHTFTTDDGEVELKCPTEVAITDRREKELAELGFIA
LTHCKGTDYAAFFSTQSVQKPKEYDSDSANANARISCQLQYIMATSRFAHYLKSMVRDKIGSFMSRSECE
YFLNQWISNYVVGSDDAGQDIKAKYPLREARIDVSDIPGKPGFYKAVAYLKPHFQLEGLTASLRLVADLP
PPAQG
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|158512110|gb|AY424360|evpB|:4943-6430
ATGAGCGAACAGAACTTGCCAGAAAGTAGCGCCGCCGAGAGCGCTGCGCTAGAGGGCGGCCTGCTGGATA
GCATCATTGCGGAAACCCGGATGGCACGCAGTGATCTGGAGAAGGCGCGGGCCCGGGATCTGCTGGGGGA
ATGGGTCAGTGAGGTTCTGTCGGGCACCGTGACGGTATCCGGTGATGTGCTGGCCAGCATTGAGGCGCGT
ATCGCCCAGATCGATGCGCTGCTCTCCGCCCAGCTCTCCGCCATTATGCATGAGCCGGCGTTCCAAAAGC
TGGAGGGGTCATGGCGTGGGCTGCATTACCTGGTGCATCAAAGCGAAACCGGTACCGGCCTGAAAATCCG
CATGCTGAACGTCAGCCGAGCCGATCTGATCCGCGACTTTAAGAGCGCCGCCGAGTTTGATCAGAGCGCG
CTGTTCAAGAAAGTCTATGAGGAGGAGTACGGTACCTTTGGCGGCGCCCCCTTTGCGGCCATGATCGGAG
ATTATGAGTTCAGCAACCACCCGGAAGATCTATTCCTGCTGGAGGAGATCTCACACGTTGCGGCGGCGGC
CCATGCCCCCTTCCTCTCTGCCGCCAGCGCAGGAATGTTCGGCCTGGATAGCCTGACAGAGCTGTCGATC
CCCCGGGATCTGGCCAAGGGCTTTGATACGGTTGAGTATGCCAAGTGGAAATCGCTGCGCCAGTCAGAGG
ATGCCCGCTATATCGCCCTGGCCCTGCCCCACGTGCTTGGCCGACTGCCTTACGGCGCGACGACGGTGCC
GGTCGAGTCATTCAATTTTGAGGAGAATGTCAGCGGCAAGGAGCATGGCAAATATCTGTGGCTGAATGCC
GCCTATGCGCTGGGCACCCGCCTGACTCAGGCCTATGCCAAATATGGCTGGTGCGCCGCCATCCGGGGTG
CCGAGGGGGGAGGCCTGGTGGAGGGACTGCCGGCGCACACCTTTACCACCGATGATGGCGAAGTCGAGCT
CAAGTGCCCCACCGAAGTGGCCATTACCGATCGCCGAGAGAAAGAGCTGGCCGAGCTGGGATTTATCGCC
CTGACCCACTGTAAGGGGACCGACTATGCCGCCTTCTTTTCGACCCAATCGGTGCAAAAGCCCAAGGAAT
ATGACAGTGACTCGGCCAATGCCAACGCCAGGATCTCCTGCCAGCTGCAATATATTATGGCCACCTCACG
CTTTGCCCATTATTTAAAATCGATGGTCCGCGACAAAATCGGCAGCTTTATGAGCCGCAGTGAGTGTGAA
TATTTTCTCAATCAGTGGATCAGTAATTATGTGGTCGGCTCGGATGATGCTGGCCAGGATATCAAGGCGA
AATATCCATTACGGGAAGCCCGCATTGATGTCAGTGATATTCCGGGCAAACCGGGTTTCTATAAGGCGGT
AGCCTATTTAAAACCCCATTTCCAACTGGAGGGGCTGACCGCGTCTTTACGTCTGGTCGCCGATCTGCCG
CCACCGGCGCAAGGCTAA