SecReT6
Protein ID: 40287638
SecReT6 ID791
T6SS typei4b
Gene symbolevpC
Locus tagEvpC
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]6500..6991 [+]
ProductEvpC
NoteTssD
UniProt IDQ6EE19, Q6EE19
KEGG IDNA
PDB ID3EAA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-35, Aligned region: 6..137
Protein Sequence: 163 a.a.     [Download]
>gi|40287638|ref|AAR83929.1| EvpC [Edwardsiella tarda]
MAFDTYIKLDKVDGESTDDKHKKWIEVLGFAWGAGNECTMESGTQGLNTGKAMMSVLRVTKWMDCASVKL
ASAAVQGQNFPTLELEICTQAGDKFAFCIYKFTHVAVSSYQCSGATGGSDRPQETIDFAYKEVTWEYVPQ
DQNGKAGGKIGPEGWSLITNKKK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|158512110|gb|AY424360|evpC|:6500-6991
ATGGCTTTTGATACTTATATCAAACTGGATAAGGTTGATGGGGAATCCACCGACGATAAGCACAAAAAAT
GGATTGAAGTGCTGGGTTTTGCCTGGGGCGCGGGCAATGAATGCACGATGGAGAGCGGCACCCAGGGGCT
GAATACCGGTAAGGCGATGATGTCGGTGCTGCGTGTCACCAAATGGATGGACTGCGCCAGTGTCAAGCTG
GCCTCCGCCGCCGTGCAGGGGCAGAACTTTCCCACGCTGGAGCTGGAGATTTGCACCCAGGCGGGCGATA
AGTTCGCCTTCTGCATCTACAAATTTACGCATGTCGCCGTCTCCAGCTATCAATGCTCAGGGGCCACGGG
CGGCAGCGATCGCCCGCAGGAAACCATTGATTTCGCTTATAAAGAAGTGACATGGGAATACGTTCCCCAG
GATCAGAACGGCAAGGCGGGCGGCAAAATTGGTCCTGAGGGCTGGAGCCTTATTACCAACAAGAAAAAGT
AA