SecReT6
Protein ID: 403059665
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032260
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3648218..3648736 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDJ7L1H6
KEGG IDpcc:PCC21_032260
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-34, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|403059665|ref|YP_006647882.1| type VI secretion system effector [Pectobacterium carotovorum subsp. carotovorum PCC21]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHIVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDSTIVDIDCKMPHCQDPSKLDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3648736-3648218 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACTCAGGGCAACATTACTGCGGGTGCTTTCACTT
CTGATTCTGTCGGCAACATCTATGTGGAAGGCCACGAAGACGAAATGCTGGTTCAGGAATTCAAACACAT
TGTCACCGTACCGACCGACCCACAGTCTGGTCAGCCGTCCGGCCAGCGTGTACACAAGCCGTTCAAATTC
ACCGTCGCGCTGAACAAAGCGGTTCCACTGATGTACAACGCCCTGGCGTCTGGCGAAATGCTGCCGACCG
TGACCCTGAAATGGTACCGCACGTCGGTTGAAGGTAAGCAAGAACACTTCTTCTCTACCGTGTTGACTGA
CTCCACCATCGTGGACATCGACTGCAAAATGCCACACTGCCAGGACCCGTCAAAACTGGACTACACCCAG
CTGATCGAAGTGTCGCTGGCCTACCGCAAAATCGATTGGGAGCACACCGTTGCCGGGACTTCCGGCTCTG
ATGACTGGCGTGCACCGGTCGAAGCGTAA