SecReT6
Protein ID: 403059667
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032280
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3650739..3652175 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDJ7KVS7
KEGG IDpcc:PCC21_032280
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.20E-40, Aligned region: 326..473
ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 39..98
Protein Sequence: 478 a.a.     [Download]
>gi|403059667|ref|YP_006647884.1| ImpA domain-containing protein [Pectobacterium carotovorum subsp. carotovorum PCC21]
MQDAQQALKVGRDPRMLPEFDALRAEINKLSHASRPDVDWMLVHDMATTIFEKQGVDLQTAIYFTLARSR
LAGLTGFTESCEFLANLIVTQWDNFWPPVHQERARIEMLDWFIARISEVVRQYAISHEHKRLVYRCERAL
QLMSEKLHNSGLSRIPRVENLLHFVEGYTHLFDETEIVIVSDDQELKKQDMQIPPMVFFHSDMEPGATVQ
SSGSSGSGQAALPAGSILIGREKGQMKPTVLKIEAHKKQKPAWFWFVSGLLTCALPVAAITGWQYWQEQK
ADALALLQQPAYALPAAPDHNDIRRVRIALGEQKLQGMEGELINRYQAQLEQVKNASPFYLYEYGNGLKN
VMQQLYPDSLAVKEMERQWQIALERQQGDEPKTRGYEQARARVNDTLQQLLELERQRRTVTISYLKSKLY
DMQKDLISDVPFGIRLRELEARKTRNQSLTPAELRVMEDELRAFNVRLYRLQQGNSAS
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3652175-3650739 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGCAAGATGCACAACAGGCCCTGAAAGTCGGCCGCGATCCACGGATGCTGCCGGAGTTTGACGCACTTC
GGGCGGAAATTAACAAGTTGAGTCACGCGTCTCGCCCTGATGTGGACTGGATGCTGGTGCACGATATGGC
CACCACCATCTTTGAAAAACAGGGCGTGGATCTCCAGACCGCGATCTACTTTACGCTGGCACGTTCGCGG
TTGGCGGGGTTGACCGGCTTCACGGAAAGCTGTGAGTTTCTGGCGAATTTGATCGTGACGCAGTGGGATA
ACTTTTGGCCGCCGGTGCATCAGGAACGGGCGCGTATCGAGATGCTGGACTGGTTTATTGCCCGCATCAG
CGAAGTGGTGCGGCAGTACGCCATCAGCCATGAACACAAGCGGCTGGTTTACCGTTGCGAACGCGCGCTG
CAATTGATGAGTGAAAAGCTGCACAACTCGGGGCTGAGCCGCATTCCTCGCGTCGAGAATCTGCTGCACT
TCGTCGAAGGCTATACCCATTTGTTTGATGAAACCGAGATTGTCATTGTGTCGGACGATCAGGAACTGAA
AAAGCAGGATATGCAGATTCCACCCATGGTGTTCTTTCATTCAGACATGGAGCCCGGCGCGACGGTGCAA
AGCAGTGGTTCATCAGGCTCGGGTCAGGCTGCTCTGCCTGCGGGCAGTATTCTCATCGGACGGGAGAAAG
GGCAAATGAAACCGACGGTATTGAAGATTGAGGCGCATAAAAAGCAGAAGCCCGCGTGGTTTTGGTTTGT
CTCCGGGCTGCTGACCTGTGCGCTGCCTGTCGCGGCCATTACAGGCTGGCAGTATTGGCAGGAACAGAAA
GCTGATGCGCTGGCGCTATTGCAACAGCCAGCGTATGCGTTGCCTGCCGCCCCCGATCATAATGACATTC
GCCGGGTGCGTATTGCGCTGGGCGAACAGAAATTGCAAGGCATGGAAGGTGAGCTGATTAACCGCTATCA
GGCACAGCTGGAGCAGGTGAAAAATGCGTCGCCGTTCTATCTGTATGAATACGGCAACGGCTTGAAAAAC
GTGATGCAGCAGCTCTATCCCGACTCGCTGGCGGTAAAAGAGATGGAACGCCAGTGGCAGATTGCGCTTG
AACGTCAGCAGGGTGATGAACCAAAAACACGCGGGTACGAACAGGCCCGTGCCAGAGTCAACGACACGTT
GCAGCAACTGCTGGAACTGGAGCGGCAGCGGCGGACGGTGACGATTTCCTACCTGAAATCAAAGCTCTAC
GATATGCAAAAAGACCTGATATCGGACGTTCCCTTTGGGATACGGCTGCGGGAACTTGAGGCGCGTAAAA
CCAGGAACCAGTCGCTGACGCCTGCGGAGCTACGTGTGATGGAAGACGAACTGCGCGCCTTCAACGTTCG
CTTGTACCGTTTGCAGCAGGGTAATTCTGCCAGCTGA