SecReT6
Protein ID: 403059669
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032300
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3655746..3657170 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDJ7KTG3
KEGG IDpcc:PCC21_032300
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-14, Aligned region: 50..109
ImpA-rel_N [PF06812], Evalue: 2.00E-14, Aligned region: 143..156
Protein Sequence: 474 a.a.     [Download]
>gi|403059669|ref|YP_006647886.1| type VI secretion-associated protein [Pectobacterium carotovorum subsp. carotovorum PCC21]
MHAHPWCKRLQTSLPDEMLRAAVLPDDPLWEKVETELVKLGSLAHNQVDLNVVAGYCLTLLESKTKDMRV
LVQLLRCLQHPAKATPFSTALMLLDSWLESYWVPAWPASPVQKQKLMIQIVRRFESALPRIAESASSAEL
EQLQQLTELVATRWGELASDKAALMDELVQGVKRARQRQQAQEQANQTAKPTPAASSSGGAGGSETSASA
ASTPVSSVEINSSDERGWRQTQLNVAALLVERHPDSPMGYRLRRHAIWSGIATPPMSSKGNKTQLAPVSS
DRVDEYQSALAQADLALWERIEQSLVLAPYWFDGHMLSASVASRLGHASVATAIAEELSAFIQRLPELRE
LAFSDGAPFLTGKCSQWLQSSQPVRGGGGARQDDLATEAAACRDEKGIGAAMQLLDERMRRLKEPRDRFY
AELVLADLLAEEGMKSLAAQHYQHMWQESQQLGLMQWEPGMVSRVERLAASRKK
 
Nucleotide Sequence: 1425 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3657170-3655746 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
ATGCATGCACATCCCTGGTGTAAACGCCTGCAAACCTCGTTGCCGGATGAGATGTTGCGCGCGGCGGTAT
TACCGGACGATCCGCTCTGGGAAAAGGTCGAAACGGAGCTGGTCAAGCTCGGATCGCTGGCGCATAACCA
GGTCGATCTTAACGTGGTGGCGGGTTACTGCCTGACCTTGCTGGAAAGCAAAACCAAAGACATGCGGGTA
CTGGTGCAGCTATTACGCTGCTTGCAGCACCCGGCCAAAGCGACTCCGTTTTCTACCGCGTTGATGCTGC
TGGACAGCTGGCTGGAGAGCTACTGGGTGCCCGCGTGGCCTGCCAGTCCGGTTCAGAAACAGAAGTTGAT
GATCCAGATTGTTCGGCGTTTTGAGAGCGCGCTGCCCCGCATTGCAGAAAGTGCATCCAGCGCAGAGCTG
GAGCAATTACAGCAGTTAACGGAGCTGGTGGCGACCCGTTGGGGCGAACTGGCCAGTGACAAAGCGGCGC
TGATGGATGAACTGGTGCAGGGCGTTAAGCGTGCCAGACAGCGACAGCAGGCGCAGGAACAGGCGAATCA
GACGGCAAAACCGACTCCGGCAGCCAGCAGCAGTGGAGGCGCGGGCGGGAGTGAAACCAGCGCCAGCGCG
GCCTCGACGCCGGTTAGTTCGGTGGAGATTAATTCATCCGATGAACGCGGCTGGCGGCAAACGCAGCTGA
ACGTTGCGGCGCTGCTGGTTGAGCGTCATCCCGATTCACCGATGGGCTACCGTCTGCGCCGCCACGCTAT
CTGGTCAGGCATTGCCACACCGCCGATGTCGTCCAAAGGGAATAAAACCCAACTGGCGCCCGTCTCGTCA
GACCGCGTGGATGAATACCAAAGTGCGCTGGCACAGGCCGATTTGGCGCTGTGGGAACGCATAGAACAAA
GTCTGGTGCTGGCTCCTTACTGGTTTGATGGCCACATGCTGTCCGCCTCGGTGGCGTCACGGCTGGGGCA
TGCTTCTGTCGCGACGGCGATTGCCGAGGAGCTTTCTGCGTTTATTCAGCGCTTGCCGGAGCTGCGTGAA
CTGGCGTTCAGCGATGGCGCGCCCTTTTTGACTGGGAAGTGTAGCCAGTGGTTGCAGTCCAGCCAGCCCG
TTCGCGGTGGCGGTGGGGCACGACAGGACGATCTGGCAACGGAGGCGGCGGCCTGTCGGGATGAGAAAGG
GATTGGGGCGGCGATGCAGTTACTGGATGAACGCATGCGTCGACTGAAAGAGCCGCGTGACCGCTTTTAT
GCCGAGTTGGTACTGGCGGATTTACTCGCCGAAGAAGGGATGAAATCACTGGCAGCACAGCACTATCAGC
ACATGTGGCAGGAAAGCCAACAATTGGGCCTGATGCAATGGGAACCGGGAATGGTCAGCCGCGTGGAGCG
GTTGGCGGCATCCCGCAAAAAATAA