SecReT6
Protein ID: 403059672
SecReT6 ID692
T6SS typei1
Gene symbol-
Locus tagPCC21_032330
StrainPectobacterium carotovorum subsp. carotovorum PCC21
Repliconchromosome [GenBank: NC_018525] [Browse all T6SS(s) in this replicon]
Location [Strand]3659283..3661880 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDJ7KVT0
KEGG IDpcc:PCC21_032330
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.60E-38, Aligned region: 277..325
AAA_2 [PF07724], Evalue: 3.60E-38, Aligned region: 602..763
AAA [PF00004], Evalue: 5.20E-18, Aligned region: 219..331
AAA [PF00004], Evalue: 5.20E-18, Aligned region: 537..563
AAA [PF00004], Evalue: 5.20E-18, Aligned region: 608..726
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 219..239
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 433..464
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 607..725
ClpB_D2-small [PF10431], Evalue: 1.20E-10, Aligned region: 427..443
ClpB_D2-small [PF10431], Evalue: 1.20E-10, Aligned region: 769..843
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 133..174
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 196..236
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 257..297
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 581..646
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 673..701
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 218..309
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 606..625
AAA_22 [PF13401], Evalue: 1.00E-07, Aligned region: 669..701
NACHT [PF05729], Evalue: 7.80E-05, Aligned region: 219..246
NACHT [PF05729], Evalue: 7.80E-05, Aligned region: 278..316
NACHT [PF05729], Evalue: 7.80E-05, Aligned region: 415..449
NACHT [PF05729], Evalue: 7.80E-05, Aligned region: 608..631
NACHT [PF05729], Evalue: 7.80E-05, Aligned region: 815..842
DUF258 [PF03193], Evalue: 0.00012, Aligned region: 184..236
DUF258 [PF03193], Evalue: 0.00012, Aligned region: 608..621
AAA_29 [PF13555], Evalue: 0.00038, Aligned region: 214..236
AAA_29 [PF13555], Evalue: 0.00038, Aligned region: 605..621
AAA_19 [PF13245], Evalue: 0.00038, Aligned region: 216..241
AAA_19 [PF13245], Evalue: 0.00038, Aligned region: 357..396
AAA_19 [PF13245], Evalue: 0.00038, Aligned region: 522..549
AAA_19 [PF13245], Evalue: 0.00038, Aligned region: 601..625
AAA_14 [PF13173], Evalue: 0.00039, Aligned region: 219..309
AAA_14 [PF13173], Evalue: 0.00039, Aligned region: 607..696
Arch_ATPase [PF01637], Evalue: 0.00039, Aligned region: 199..233
Arch_ATPase [PF01637], Evalue: 0.00039, Aligned region: 271..306
Arch_ATPase [PF01637], Evalue: 0.00039, Aligned region: 608..628
Arch_ATPase [PF01637], Evalue: 0.00039, Aligned region: 678..689
AAA_25 [PF13481], Evalue: 0.0004, Aligned region: 219..243
AAA_25 [PF13481], Evalue: 0.0004, Aligned region: 429..485
AAA_25 [PF13481], Evalue: 0.0004, Aligned region: 602..636
IstB_IS21 [PF01695], Evalue: 0.0023, Aligned region: 213..243
IstB_IS21 [PF01695], Evalue: 0.0023, Aligned region: 607..618
Clp_N [PF02861], Evalue: 0.0028, Aligned region: 24..70
Clp_N [PF02861], Evalue: 0.0028, Aligned region: 107..124
AAA_10 [PF12846], Evalue: 0.0031, Aligned region: 217..239
AAA_10 [PF12846], Evalue: 0.0031, Aligned region: 283..305
AAA_10 [PF12846], Evalue: 0.0031, Aligned region: 389..419
AAA_10 [PF12846], Evalue: 0.0031, Aligned region: 607..638
Zeta_toxin [PF06414], Evalue: 0.0032, Aligned region: 216..236
Zeta_toxin [PF06414], Evalue: 0.0032, Aligned region: 606..647
Sigma54_activat [PF00158], Evalue: 0.0038, Aligned region: 218..233
Sigma54_activat [PF00158], Evalue: 0.0038, Aligned region: 607..705
Ras [PF00071], Evalue: 0.0086, Aligned region: 219..232
Ras [PF00071], Evalue: 0.0086, Aligned region: 608..649
Protein Sequence: 865 a.a.     [Download]
>gi|403059672|ref|YP_006647889.1| type VI secretion ATPase, ClpV1 family [Pectobacterium carotovorum subsp. carotovorum PCC21]
MIRIELPTLVERLNPVCRHMLEEAAALCIQHQGAEIRIEHLLLKMLETPLCDVRQILKRAGVDADELSSL
LLPSSMDKEFDAGYPSFSPLLVEWLQDSWLLASAEFQHSRLRSGILLLVLLMTPNRYVAGAVSRPLAQIN
RELLRQQFDEWVKDSVETEVAVQSATAEQAAAANTQLSRYTQNVTESARQGQLDPVLCRDHEIDLMIDIL
SRRRKNNPIVVGEAGVGKSALIEGLALRIVAGAVPERLRDVELLTLDLGAMQAGASVKGEFEKRFKGVMQ
EVKDSPRPIVLFIDEAHTLIGAGNQAGGLDVSNLLKPALARGELRTIAATTWSEYKKYVEKDAALSRRFQ
LVKVGEPNAEEATVILRGLRGIYEKAHGVLIDEDALQAAAQLSARYISGRQLPDKAIDVLDTASARVAIN
LTTPPRAVSQLQTRLHQQEMEITQLERQARIGLGNTEERLVELREAREAGAAQLAQLEADWQQQKTRVQR
VIELRTALLDEEQSVDFDAVSAAAELAACEQALEALQQSSVLVSPHVDKTQIAAVIAEWTGVPLNRISQS
EMDVVTRLPEFLGDSIKGQQLAIAQLHKHLLTARADLRRPGRPLGAFLLVGPSGVGKTETVLQIADLMFG
GRNYLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAF
DKGELADGEGRVIDCRNVVFFLTSNLGFQTIVNYAEQSDVLLDALYPELAAFFKPALLARMEVIPYLPLA
HDTMVEIVQGKLSRLVSLLQQRFGAEVIIENEVPEEILRLANRSENGARMLESVIDGALLPPVSLQLLQR
MSAGEPVSRIHFRVEAGQFQTEVEG
 
Nucleotide Sequence: 2598 bp     [Download]
>gi|403056439|ref|NC_018525.1|:c3661880-3659283 Pectobacterium carotovorum subsp. carotovorum PCC21 chromosome, complete genome
GTGATTCGAATTGAACTGCCGACACTGGTTGAACGACTCAACCCCGTGTGCCGTCATATGCTGGAAGAAG
CGGCGGCACTCTGTATTCAACATCAGGGTGCGGAAATCCGTATTGAGCACCTGTTGCTGAAAATGCTGGA
AACGCCACTGTGCGATGTACGCCAGATCCTCAAGCGTGCGGGCGTGGATGCGGATGAGCTGTCTTCGCTG
CTGTTGCCTTCCTCCATGGATAAAGAGTTTGATGCGGGCTATCCCTCATTCTCCCCTCTGCTGGTGGAGT
GGTTACAGGATAGCTGGCTGCTGGCCTCGGCTGAATTCCAACATTCACGCCTGCGTAGCGGCATCTTGCT
GCTGGTCCTGCTGATGACGCCCAATCGCTATGTGGCTGGCGCAGTATCCCGCCCGCTGGCGCAGATTAAC
CGTGAGCTTTTACGCCAGCAGTTTGATGAGTGGGTGAAGGATTCGGTGGAAACGGAAGTCGCGGTGCAGT
CTGCCACGGCCGAACAGGCTGCTGCGGCGAACACGCAGCTCTCTCGCTATACCCAAAACGTGACGGAATC
CGCCCGGCAGGGGCAACTGGATCCGGTGCTGTGCCGCGACCATGAAATCGATCTGATGATCGACATTCTC
TCCCGTCGTCGTAAAAACAACCCGATTGTGGTCGGGGAAGCGGGCGTCGGTAAAAGTGCGCTGATCGAAG
GGCTGGCGCTACGCATCGTGGCCGGTGCCGTGCCGGAAAGACTGCGGGATGTGGAACTGCTTACGCTCGA
TTTGGGAGCGATGCAGGCCGGTGCCTCGGTGAAAGGCGAATTTGAGAAACGCTTCAAAGGCGTGATGCAG
GAAGTGAAAGATTCACCGCGCCCTATCGTTCTGTTTATCGATGAAGCGCATACGCTCATCGGCGCGGGCA
ATCAGGCGGGCGGGCTGGACGTTTCCAACCTGCTCAAGCCTGCACTGGCGCGCGGTGAACTGCGCACTAT
CGCGGCCACGACCTGGAGCGAATACAAAAAATACGTCGAGAAGGACGCTGCGCTTTCCCGCCGTTTCCAG
CTCGTCAAAGTCGGTGAACCGAATGCGGAAGAAGCCACGGTTATCTTGCGTGGGCTGCGCGGTATCTATG
AAAAGGCGCACGGTGTCCTGATTGATGAAGATGCGCTTCAGGCGGCGGCACAGCTGTCAGCCCGCTATAT
CTCCGGTCGCCAACTGCCCGATAAAGCCATCGACGTGCTGGATACGGCCAGCGCGCGCGTGGCGATTAAC
CTGACGACGCCACCGCGTGCGGTCAGCCAGTTGCAAACCCGCCTGCATCAGCAGGAGATGGAAATTACCC
AGCTTGAGCGTCAGGCGCGTATTGGTCTGGGCAATACCGAAGAACGATTAGTCGAACTGCGTGAGGCACG
CGAAGCCGGTGCGGCACAACTGGCACAGTTGGAAGCCGATTGGCAGCAGCAGAAAACGCGGGTTCAGCGC
GTGATTGAACTGCGTACAGCGCTGCTGGATGAAGAGCAGTCTGTCGATTTTGATGCGGTGTCAGCCGCGG
CGGAACTGGCGGCCTGCGAACAGGCGCTGGAAGCGCTGCAACAGTCCTCGGTACTGGTCTCTCCTCACGT
TGATAAAACGCAGATTGCGGCCGTTATTGCCGAGTGGACGGGCGTGCCGCTGAACCGCATCTCACAGAGT
GAAATGGATGTCGTCACGCGCCTGCCTGAATTCCTGGGGGATTCAATTAAAGGGCAGCAGTTAGCGATCG
CTCAATTGCATAAACATCTGCTGACCGCGCGTGCGGATCTTCGTCGTCCGGGGCGTCCGCTGGGGGCTTT
CCTGTTGGTCGGGCCGAGCGGCGTAGGTAAAACGGAAACCGTGCTCCAGATTGCCGATCTGATGTTTGGC
GGACGCAACTATCTGACCACCATCAATATGTCGGAATATCAGGAAAAACATACGGTTTCACGCCTGATCG
GTTCGCCGCCGGGCTACGTCGGGTTTGGTGAAGGCGGTGTGTTAACCGAAGCCATCCGCCAGAAACCGTA
TTCCGTGGTGCTGCTGGATGAGGTAGAGAAGGCGCACCCAGATGTCCTGAACCTGTTCTATCAGGCGTTT
GATAAAGGTGAACTCGCCGATGGCGAAGGCCGGGTGATCGACTGCCGCAACGTGGTGTTCTTCCTGACGT
CCAACCTCGGGTTCCAAACGATTGTGAACTACGCCGAGCAGTCGGATGTGTTGCTGGATGCGCTCTATCC
CGAACTTGCAGCCTTCTTCAAACCCGCACTCCTGGCGCGTATGGAAGTCATTCCTTACCTGCCGCTGGCG
CATGACACCATGGTTGAGATCGTACAAGGCAAACTGTCGCGTCTGGTGTCCCTGCTGCAACAGCGCTTTG
GGGCGGAAGTCATCATTGAGAACGAGGTGCCGGAAGAGATTCTGCGGTTGGCAAACCGCAGCGAAAACGG
CGCGCGTATGCTCGAATCGGTAATTGATGGCGCCTTGCTGCCGCCGGTCTCGCTACAGCTGCTGCAACGC
ATGTCGGCGGGTGAGCCTGTCAGCCGTATTCATTTCCGTGTCGAAGCCGGCCAGTTCCAGACTGAGGTTG
AGGGCTGA